DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG31269

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:269 Identity:72/269 - (26%)
Similarity:114/269 - (42%) Gaps:47/269 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGH--NTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGE 193
            |::||.  ..|...:.    :..:.:||.  ::||.:.|.:.::||||||:..........:.|.
  Fly    37 RIIGGQAAEDGFAPYQ----ISLQGISGA--HSCGGAIINETFVLTAAHCVENAFIPWLVVVTGT 95

  Fly   194 WNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEP 258
             |:...|.....|..:      ||         |..|......||||||.|..|:.|.:.....|
  Fly    96 -NKYNQPGGRYFLKAI------HI---------HCNYDNPEMHNDIALLELVEPIAWDERTQPIP 144

  Fly   259 VCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQ--PQDQCQEAFYKDTKITLAD 321
            :.|.|.:       .|....::|||.|...|:|.|..: :|::|  |..:|:.....|....:  
  Fly   145 LPLVPMQ-------PGDEVILTGWGSTVLWGTSPIDLQ-VLYLQYVPHRECKALLSNDEDCDV-- 199

  Fly   322 SQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMD 386
            ..:|....:|..:|.|||||||     .::|    ||.|:|:.|.. |.|.: ..::..|..|.|
  Fly   200 GHICTFSRLGEGACHGDSGGPL-----VSNG----YLVGLVNWGWP-CATGV-PDVHASVYFYRD 253

  Fly   387 WIESTIRAN 395
            ||.:.:..|
  Fly   254 WIRNVMSGN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 69/260 (27%)
Tryp_SPc 133..391 CDD:238113 70/261 (27%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 69/260 (27%)
Tryp_SPc 38..258 CDD:238113 70/262 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.