DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG32808

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster


Alignment Length:270 Identity:88/270 - (32%)
Similarity:128/270 - (47%) Gaps:43/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWN 195
            ::|.|...|..|||:...|  .....|: ::|||:.:...|:||||||:                
  Fly    29 KIVNGTTAGPGEFPFVVSL--RRAKSGR-HSCGATLLNPYWVLTAAHCV---------------- 74

  Fly   196 RDTDPDCENDLN-GVRECAPPHIRVT-IDRILPHAQYS-ELNYRNDIALLRLSRPVNWLQMQNLE 257
            |.:.|: :.||. |.:..|....:|. :..|..|..|. |..|.||||||:|::.|...:.  ::
  Fly    75 RGSSPE-QLDLQYGSQMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKF--VQ 136

  Fly   258 PVCLPPQRGRYANQLAGSAADV-SGWGKTESSG-SSKIKQKAMLHIQPQDQCQEAFYKDTKITLA 320
            ||.||..|    ....|:|:.| :|||...:.| ..:..||..|.:....:|.|..    :..|.
  Fly   137 PVRLPEPR----QVTPGNASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSERH----QTYLH 193

  Fly   321 DSQMCAG-GEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSY 384
            |||:||| .|.|...|||||||||.:..:...       .|:||...|.|....|.|::|.||:|
  Fly   194 DSQICAGLPEGGKGQCSGDSGGPLLLIGSDTQ-------VGIVSWSIKPCARPPFPGVFTEVSAY 251

  Fly   385 MDWIESTIRA 394
            :|||..|:.:
  Fly   252 VDWIVETVNS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 85/262 (32%)
Tryp_SPc 133..391 CDD:238113 87/263 (33%)
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 85/262 (32%)
Tryp_SPc 30..258 CDD:238113 87/264 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.