DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG32376

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:296 Identity:81/296 - (27%)
Similarity:129/296 - (43%) Gaps:59/296 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 PRPPSGIDQLPEHPYCGS-----AFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIA 168
            |.|..|  .:..:|:..:     :|..|:|.|......|.|:...|.||..     :.||...|.
  Fly    40 PTPNFG--NISSNPFINALEAQESFPTRIVNGKRIPCTEAPFQGSLHYEGY-----FVCGCVIIN 97

  Fly   169 QRWLLTAAHCIHTMGRNLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSEL 233
            :.|:|||.||........|..:..:..|             |.....|::    :|:..|.|::.
  Fly    98 KIWILTAHHCFFGPPEKYTVRVGSDQQR-------------RGGQLRHVK----KIVALAAYNDY 145

  Fly   234 NYRNDIALLRLSRPVNWLQMQNLEPVCLPPQR-GRYANQLAGSAADVSGWGKTESSGSSKIKQKA 297
            ..|:|:|:::|..||.:.:.  :.||.||..: .::..:..     |||||.|  |.:::..|:.
  Fly   146 TMRHDLAMMKLKSPVYFGKC--VRPVKLPSTKTTKFPKKFV-----VSGWGIT--SANAQNVQRY 201

  Fly   298 MLHIQ----PQDQCQEAFYKDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYL 358
            :..:|    .:.:||: .||...:.:....:|| .....||||||||||||        :|.| |
  Fly   202 LRRVQIDYIKRSKCQK-MYKKAGLKIYKDMICA-SRTNKDSCSGDSGGPLT--------SRGV-L 255

  Fly   359 AGVVS--IGRKHCGTALFSGIYTRVSSYMDWIESTI 392
            .|:||  ||   |....:.|:|.....|:.||:..|
  Fly   256 YGIVSWGIG---CANKNYPGVYVNCKRYVPWIKKVI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 73/263 (28%)
Tryp_SPc 133..391 CDD:238113 74/264 (28%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 73/263 (28%)
Tryp_SPc 66..287 CDD:238113 74/265 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.