DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Klk15

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_777354.1 Gene:Klk15 / 317652 MGIID:2447533 Length:254 Species:Mus musculus


Alignment Length:264 Identity:90/264 - (34%)
Similarity:118/264 - (44%) Gaps:57/264 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 PWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWN-RDTDPDCENDLN 207
            ||...| :|.   |: :.|||..|:.||:||||||.....|    ..|||.| |..|        
Mouse    32 PWQVAL-FER---GR-FNCGAFLISPRWVLTAAHCQTRFMR----VRLGEHNLRKFD-------- 79

  Fly   208 GVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQL 272
                 .|..:| ::.||:||..|....:|:||.||||.:|......  :.||.||.:     ..|
Mouse    80 -----GPEQLR-SVSRIIPHPGYEARTHRHDIMLLRLFKPARLTAY--VRPVALPRR-----CPL 131

  Fly   273 AGSAADVSGWG-----KTESSGSSK--IKQKAMLH-----IQPQDQCQEAFYKDTKITLADSQMC 325
            .|....|||||     ...::||.|  ::....||     |..:..|.    ||....:..:.:|
Mouse   132 IGEDCVVSGWGLLSDNNPGATGSQKSHVRLPDTLHCANISIISEASCN----KDYPGRVLPTMVC 192

  Fly   326 AGGE-IGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIE 389
            ||.| .|.|||.|||||||....         .|.|:||.|...|.|....|:||:|.||::||.
Mouse   193 AGVEGGGTDSCEGDSGGPLVCGG---------ALQGIVSWGDVPCDTTTKPGVYTKVCSYLEWIW 248

  Fly   390 STIR 393
            ..:|
Mouse   249 ENVR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 87/257 (34%)
Tryp_SPc 133..391 CDD:238113 89/260 (34%)
Klk15NP_777354.1 Tryp_SPc 23..247 CDD:238113 87/257 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.