DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Tmprss6

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_006242057.1 Gene:Tmprss6 / 315388 RGDID:1307138 Length:811 Species:Rattus norvegicus


Alignment Length:389 Identity:110/389 - (28%)
Similarity:165/389 - (42%) Gaps:79/389 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GTCIEK----KDCDFYAVDKLMELASKQQCFSRQRPDLVC------CPRETNIIPPLAPRISNGT 91
            |.|:..    |||.....::.....:..||    :.|..|      |.|:        |...||:
  Rat   468 GLCVPACDGIKDCPNGLDERNCVCRAMFQC----QEDSTCISLPRVCDRQ--------PDCLNGS 520

  Fly    92 ------TNATSSTTTLKLLPRTTPRPPS-----------GIDQLPEHPYCG-SAFSFRLVGGHNT 138
                  ......|.|.:...|:..:.|:           |.|:  ||..|| ...|.|:|||..:
  Rat   521 DEEQCQEGVPCGTFTFQCEDRSCVKKPNPECDGQADCRDGSDE--EHCDCGLQGPSSRIVGGAMS 583

  Fly   139 GLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIH---TMGRNLTAAILGEWNRDTDP 200
            ...|:||...|:..    |: :.||.:.||.||::|||||..   .....|....||:..:::. 
  Rat   584 SEGEWPWQASLQIR----GR-HICGGALIADRWVITAAHCFQEDSMASPRLWTVFLGKMRQNSR- 642

  Fly   201 DCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQR 265
                        .|..:...:.|:..|..:.|.::..|:|||:|..||  :....:.|||||.:.
  Rat   643 ------------WPGEVSFKVSRLFLHPYHEEDSHDYDVALLQLDHPV--VYSATVRPVCLPARS 693

  Fly   266 GRYANQLAGSAADVSGWGKTESSG-SSKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQMCAGGE 329
            ..:.   .|....::|||.....| .|...||..:.:.|||.|.||:    :..:....:|||..
  Rat   694 HFFE---PGQHCWITGWGAQREGGPGSSTLQKVDVQLIPQDLCNEAY----RYQVTPRMLCAGYR 751

  Fly   330 IG-VDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIESTI 392
            .| .|:|.|||||||.  ....|| |: :|||:||.| ..||...|.|:||||:..::||:..:
  Rat   752 KGKKDACQGDSGGPLV--CKEPSG-RW-FLAGLVSWG-LGCGRPNFFGVYTRVTRVVNWIQQVL 810

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 9/46 (20%)
Tryp_SPc 131..388 CDD:214473 83/261 (32%)
Tryp_SPc 133..391 CDD:238113 84/262 (32%)
Tmprss6XP_006242057.1 SEA 88..185 CDD:279699
LDLa 459..489 CDD:238060 5/20 (25%)
LDLa 495..525 CDD:238060 9/41 (22%)
Ldl_recept_a 529..566 CDD:278486 7/38 (18%)
Tryp_SPc 576..806 CDD:214473 83/261 (32%)
Tryp_SPc 577..809 CDD:238113 84/263 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.