DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Ovch2

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_003749007.2 Gene:Ovch2 / 308919 RGDID:1564636 Length:579 Species:Rattus norvegicus


Alignment Length:306 Identity:86/306 - (28%)
Similarity:133/306 - (43%) Gaps:71/306 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 PYCG------------SAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLT 174
            |.||            |.|| |:|||.......:||...|:.:     :.:.||.:.|:.:|::|
  Rat    31 PDCGKSLVKPWPQNYFSLFS-RIVGGSQVEKGSYPWQVSLKQK-----QKHICGGTIISSQWVIT 89

  Fly   175 AAHCIH----TMGRNLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYS---E 232
            ||||:.    .:..|:||.             |:||:   :..|....:.|:.|:.|.|:|   .
  Rat    90 AAHCMANRNIALTLNVTAG-------------EHDLS---QAEPGEQTLAIETIIIHPQFSTKKP 138

  Fly   233 LNYRNDIALLRLSRPVNWLQM-QNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGS-SKIKQ 295
            :||  |||||::   |...|. |.:.|||| |:.|...|  ||.....:|||:....|| .::.|
  Rat   139 MNY--DIALLKM---VGTFQFGQFVRPVCL-PEPGEQFN--AGYICTTAGWGRLSEGGSLPQVLQ 195

  Fly   296 KAMLHIQPQDQCQEAFYKDTKITLADSQMCAGG-EIGVDSCSGDSGGPLTVEANTASGNRYVYLA 359
            :..|.|...::|:.............:.:|.|. :.|.|:|.|||||.|..:....:..    ||
  Rat   196 QVNLPILTHEECEAVMLTLRNPITGKTFLCTGSPDGGRDACQGDSGGSLMCQNRKGAWT----LA 256

  Fly   360 GVVSIG------------RKHCGTALFSGIYTRVSSYMDWIESTIR 393
            ||.|.|            :|..|:   .||:|.:...:.||...::
  Rat   257 GVTSWGLGCGRSWRNNARKKEQGS---PGIFTDLRRVLPWIHEHVQ 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 78/278 (28%)
Tryp_SPc 133..391 CDD:238113 79/279 (28%)
Ovch2XP_003749007.2 Tryp_SPc 52..297 CDD:238113 79/280 (28%)
CUB 317..420 CDD:238001
CUB 431..541 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.