DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Klk14

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_038956840.1 Gene:Klk14 / 308562 RGDID:1308606 Length:310 Species:Rattus norvegicus


Alignment Length:320 Identity:90/320 - (28%)
Similarity:130/320 - (40%) Gaps:78/320 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 PRPPSGIDQLPEHP------YCGSAFSF-------------------RLVGGHNTGLFEFPWTTL 148
            |:|.||:....||.      ..||....                   :::||:.......||...
  Rat    36 PKPSSGLCGEQEHMGFLQTWTSGSRMLLLLTILQALAVAIVQSQGDDKILGGYTCVQNSQPWQVA 100

  Fly   149 LEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNRDTDPDCENDLNGVR--E 211
            |:   ...|:.:.||...::.:|::|||||    .|.|....||:.|             :|  |
  Rat   101 LQ---AGPGRRFLCGGVLLSDQWVITAAHC----ARPLLHVALGKHN-------------LRRWE 145

  Fly   212 CAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPV---CLPPQRGRYANQLA 273
            .....:||.  |.:||.||....:.||:.||:|.|.|...:.....||   |..|          
  Rat   146 ATQQVLRVV--RQVPHPQYRPQAHDNDLMLLKLQRKVRLGRAVRTIPVARSCASP---------- 198

  Fly   274 GSAADVSGWGKTESS--GSSKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQMCAG-GEIGVDSC 335
            |:...|||||.|.|.  ......|...::|.|:..|..|:    ..|:....:||| .|.|.|||
  Rat   199 GTPCRVSGWGTTASPIVRYPTALQCVNVNIMPEQVCHRAY----PGTITSGMVCAGVPEGGKDSC 259

  Fly   336 SGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIESTIRAN 395
            .|||||||..:..         |.|:||.|.:.|....:.|:||.:.:|..||:.|:::|
  Rat   260 QGDSGGPLVCQGQ---------LQGLVSWGMERCAMPGYPGVYTNLCNYHSWIQRTMQSN 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 78/264 (30%)
Tryp_SPc 133..391 CDD:238113 80/265 (30%)
Klk14XP_038956840.1 Tryp_SPc 84..306 CDD:238113 80/266 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.