DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Tmprss11e

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_038948843.1 Gene:Tmprss11e / 305265 RGDID:1561698 Length:444 Species:Rattus norvegicus


Alignment Length:267 Identity:86/267 - (32%)
Similarity:124/267 - (46%) Gaps:41/267 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 SFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGE 193
            |.|:|||.:....|:||.:.|:::     ..:.|||:.|:..||::||||..|            
  Rat   210 SVRIVGGTSAEEGEWPWQSSLQWD-----GSHRCGATLISNTWLVSAAHCFRT------------ 257

  Fly   194 WNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEP 258
               ..||.......|. ...||.:...|.||:.|.:|:..::..||||:.|||||.....  :..
  Rat   258 ---HKDPSRWTASFGA-TLQPPKLTTGIRRIIVHEKYNYPSHDYDIALVELSRPVPCTNA--VHK 316

  Fly   259 VCLPPQRGRYANQLAGSAADVSGWGKTESSGSSK--IKQKAMLHIQPQDQCQEAFYKDTKITLAD 321
            ||||.....:.   .|....|:|:|...:.|.::  ::|..:.:|..|...:...|..   .:..
  Rat   317 VCLPDANHEFQ---PGQRMFVTGFGALRNDGFAQNYLRQVQVDYIDTQTCNRPQSYNG---AITP 375

  Fly   322 SQMCAG---GEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSS 383
            ..:|||   ||  .|:|.|||||||.    |.......|||||||.| ..||.....|:||||::
  Rat   376 RMLCAGFLKGE--KDACQGDSGGPLV----TPDVRDVWYLAGVVSWG-DECGQPNKPGVYTRVTA 433

  Fly   384 YMDWIES 390
            :.|||.|
  Rat   434 FRDWITS 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 82/261 (31%)
Tryp_SPc 133..391 CDD:238113 84/263 (32%)
Tmprss11eXP_038948843.1 SEA 71..176 CDD:396113
Tryp_SPc 213..441 CDD:238113 84/264 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.