DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Tpsg1

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:293 Identity:89/293 - (30%)
Similarity:124/293 - (42%) Gaps:58/293 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 PYCG---------------SAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRW 171
            ||||               |....|:||||......:||...|..:.|     :.||.|.::..|
  Rat     5 PYCGFLLLLAVPGCGQPQVSHAGSRIVGGHAAQAGAWPWQASLRLQKV-----HVCGGSLLSPEW 64

  Fly   172 LLTAAHCIHTMGRNLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSEL--- 233
            :||||||..           |..|   ..|.|..|..:.....||.. |:.:|:   .||..   
  Rat    65 VLTAAHCFS-----------GSVN---SSDYEVHLGELTITLSPHFS-TVKQII---MYSSAPGP 111

  Fly   234 -NYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIK--- 294
             ....||||::|:.||. |..| ::|||||...   |:...|....|:|||.|:.....|..   
  Rat   112 PGSSGDIALVQLATPVA-LSSQ-VQPVCLPEAS---ADFHPGMQCWVTGWGYTQEGEPLKPPYNL 171

  Fly   295 QKAMLHIQPQDQCQEAFYKDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLA 359
            |:|.:.:...:.|.:|:.......:....:||.|.  .|:|..||||||...   .:|  ....|
  Rat   172 QEAKVSVVDVETCSQAYSSSNGSLIQSDMLCAWGP--GDACQDDSGGPLVCR---VAG--IWQQA 229

  Fly   360 GVVSIGRKHCGTALFSGIYTRVSSYMDWIESTI 392
            ||||.| :.||.....|:|.||::|::||...|
  Rat   230 GVVSWG-EGCGRPDRPGVYARVTAYVNWIHRHI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 81/263 (31%)
Tryp_SPc 133..391 CDD:238113 82/264 (31%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 81/263 (31%)
Tryp_SPc 30..260 CDD:238113 82/265 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.