DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Prss22

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001100454.1 Gene:Prss22 / 302971 RGDID:1310880 Length:307 Species:Rattus norvegicus


Alignment Length:332 Identity:81/332 - (24%)
Similarity:139/332 - (41%) Gaps:66/332 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 PPLAPRISNGTTNATSSTTTLKLLPRTTPRPPSGIDQLPEHPYCGSAFSF-RLVGGHNTGLFEFP 144
            ||||        .......||.||...|.........:...|.||..... |:|||.::...::|
  Rat     6 PPLA--------LGGDQFRTLILLVLLTSTATVSAANIRGSPDCGKPQQLNRVVGGEDSADAQWP 62

  Fly   145 WTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLT-----AAILGEWNRDTDPDCEN 204
            |...:    :..|..: |..|.:..||:::||||..:   |:.     :.:||.|.         
  Rat    63 WIVSI----LKNGSHH-CAGSLLTNRWVVSAAHCFSS---NMDKPSPYSVLLGAWK--------- 110

  Fly   205 DLNGVRECAPPHIRVTIDRILPHAQYSELNYRN-DIALLRLSRPVNWLQMQNLEPVC-------L 261
                :....|...:|.|..:|||.:||.....: ||||:||.||:.:  .:.:.|:|       |
  Rat   111 ----LGNPGPRSQKVGIASVLPHPRYSRKEGTHADIALVRLERPIQF--SERILPICLPDSSVHL 169

  Fly   262 PPQRGRYANQLAGSAADVSGWGKTESS---GSSKIKQKAMLHIQPQDQCQEAFYKDT-KITLADS 322
            ||....:          ::|||..:..   ...:..||..:.|...:.|:..:::.. :..:.:.
  Rat   170 PPNTNCW----------IAGWGSIQDGVPLPRPQTLQKLKVPIIDPELCKSLYWRGAGQEAITED 224

  Fly   323 QMCAGGEIGV-DSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMD 386
            .:|||...|. |:|.|||||||..:.:.     :..|.|::|.| :.|......|:||.:.::..
  Rat   225 MLCAGYLEGKRDACLGDSGGPLMCQVDD-----HWLLTGIISWG-EGCAERNRPGVYTSLLAHRP 283

  Fly   387 WIESTIR 393
            |::..::
  Rat   284 WVQRIVQ 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 68/274 (25%)
Tryp_SPc 133..391 CDD:238113 68/275 (25%)
Prss22NP_001100454.1 Tryp_SPc 49..285 CDD:214473 68/274 (25%)
Tryp_SPc 50..288 CDD:238113 68/276 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.