DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Prss32

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001100453.1 Gene:Prss32 / 302970 RGDID:1311905 Length:334 Species:Rattus norvegicus


Alignment Length:330 Identity:93/330 - (28%)
Similarity:149/330 - (45%) Gaps:57/330 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 IIPPLAPRISNGTTNATSSTTTLKLLPRTTPRPPSGIDQLPEHPYCG-SAFSFRLVGGHNTGLFE 142
            |:..|.|.:..|:...|:.:.:|.   ..|.|....:|.:     || ...|.|:|.|.|..|.:
  Rat     8 ILYTLLPGVLLGSEVLTTDSYSLS---TQTGRSSIDLDSV-----CGRPRASGRIVSGQNAQLGQ 64

  Fly   143 FPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCI----HTMGRNLTAAILGEWNRDTDPDCE 203
            :||...:..:.|     :.||.|.|::.|:||||||.    |.....:....:..:..|.:|   
  Rat    65 WPWQVSVREDGV-----HVCGGSLISEDWVLTAAHCFNQDQHLSAYTVLLGTISSYPEDNEP--- 121

  Fly   204 NDLNGVRECAPPHIRVTIDRILPHAQYS-ELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGR 267
            .:|..|.:            .:.:..|| |.:...|||||:|:.|:::  ...:.|||||    :
  Rat   122 RELRAVAQ------------YIKYPSYSAEEHSSGDIALLQLASPISF--NDYMLPVCLP----K 168

  Fly   268 YANQL-AGSAADVSGWGKTESSGSSK---IKQKAMLHIQPQDQC----QEAFYKDTKITLADSQM 324
            ..:.| .|:...|:|||...::....   ..|:..:.:.....|    ||.....|:..:.:..:
  Rat   169 PGDPLDPGTMCWVTGWGNIATNQPLPPPFTLQELQVPLIDAKTCNTYYQENSVPSTEQVILEDML 233

  Fly   325 CAGGEIG-VDSCSGDSGGPLTVEANTASGNRYVYL-AGVVSIGRKHCGTALFSGIYTRVSSYMDW 387
            |||...| .|:|:|||||||..:.|.      |:: |||||.| ..|..:...|:||.||.|:.|
  Rat   234 CAGFVEGKKDACNGDSGGPLVCDVND------VWIQAGVVSWG-SDCALSNRPGVYTNVSVYISW 291

  Fly   388 IESTI 392
            |::|:
  Rat   292 IQNTM 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 78/271 (29%)
Tryp_SPc 133..391 CDD:238113 79/272 (29%)
Prss32NP_001100453.1 Tryp_SPc 53..292 CDD:214473 78/271 (29%)
Tryp_SPc 54..295 CDD:238113 79/273 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.