DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Tmprss13

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001121000.1 Gene:Tmprss13 / 300682 RGDID:1310872 Length:539 Species:Rattus norvegicus


Alignment Length:279 Identity:88/279 - (31%)
Similarity:135/279 - (48%) Gaps:39/279 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 YCG-SAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNL 186
            :|| .|.:.|:|||..|...::||...|.:     |..:.||.:.|..:|:||||||....... 
  Rat   288 HCGLRAMTGRIVGGALTSESKWPWQVSLHF-----GTTHICGGTLIDAQWVLTAAHCFFVTREK- 346

  Fly   187 TAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWL 251
               ||..|.....   .::|:.:.|.|      :|.:|:.:..|::.....||||:|||:|:.  
  Rat   347 ---ILEGWKVYAG---TSNLHQLPEAA------SISQIIINGNYTDEQDDYDIALVRLSKPLT-- 397

  Fly   252 QMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSG--SSKIKQKAMLHIQPQDQCQEAFYKD 314
            ...::.|.|||.....:.   ......::|:|||:.:.  :|...::..:::....:|.:....|
  Rat   398 LSAHIHPACLPLHGQTFG---LNETCWITGFGKTKETDEKTSPFLREVQVNLIDFKKCNDYLVYD 459

  Fly   315 TKITLADSQMCAGG-EIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIY 378
            :.:|  ...||||. ..|.|||.|||||||..|.|    ||: |||||.|.| ..||.....|:|
  Rat   460 SYLT--PRMMCAGDLRGGRDSCQGDSGGPLVCEQN----NRW-YLAGVTSWG-TGCGQKNKPGVY 516

  Fly   379 TRVSSYMDWI----ESTIR 393
            |:|:..:.||    ||.:|
  Rat   517 TKVTEVLPWIYRKMESEVR 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 80/259 (31%)
Tryp_SPc 133..391 CDD:238113 82/264 (31%)
Tmprss13NP_001121000.1 WWbp <1..69 CDD:304964
SRCR_2 203..292 CDD:292133 2/3 (67%)
SRCR 216..288 CDD:278931 88/279 (32%)
Tryp_SPc 297..526 CDD:214473 80/259 (31%)
Tryp_SPc 298..526 CDD:238113 79/258 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.