DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Habp2

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001001505.2 Gene:Habp2 / 292126 RGDID:1302979 Length:558 Species:Rattus norvegicus


Alignment Length:316 Identity:96/316 - (30%)
Similarity:151/316 - (47%) Gaps:58/316 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 LKLLPRTTPRPPSG-----IDQLPEHPYCGSAFSF-----RLVGGHNTGLFEFPWTTLLEYE--- 152
            :::.|.:....|.|     :.:||....||.....     |:.||..:...:.||...|:..   
  Rat   271 VEVCPESDAANPLGSLQEPVMELPGFDSCGKTEMTEHAVKRIYGGFKSTAGKHPWQVSLQTSLPL 335

  Fly   153 TVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNRDTDPDCENDLNGVRECAPPHI 217
            |.|..:.:.||.|.|...|:||||||.....::| ..:||:.:.......|....          
  Rat   336 TTSMPQGHFCGGSLIHPCWVLTAAHCTDMSTKHL-KVVLGDQDLKKTESHEQTFR---------- 389

  Fly   218 RVTIDRILPHAQYSELNY--RNDIALLRLSRPVNW---LQMQNLEPVCLP----PQRGRYANQLA 273
               :::||.::||:|.:.  .||||||:| :||..   |:.:.::.||||    |         :
  Rat   390 ---VEKILKYSQYNERDEIPHNDIALLKL-KPVGGHCALESKYVKTVCLPSDPFP---------S 441

  Fly   274 GSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQMCAGG--EIGVDSCS 336
            |:...:||||.||:...|:....|.:.:.....|......|.  |:.||.:|||.  :.|.|:|.
  Rat   442 GTECHISGWGVTETGEGSRQLLDAKVKLIANALCNSRQLYDH--TIDDSMICAGNLQKPGSDTCQ 504

  Fly   337 GDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIESTI 392
            ||||||||.|.:   |..|||  |:||.|:: ||..  .|:||:|:.:::||::|:
  Rat   505 GDSGGPLTCEKD---GTYYVY--GIVSWGQE-CGKK--PGVYTQVTKFLNWIKTTM 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 86/270 (32%)
Tryp_SPc 133..391 CDD:238113 87/271 (32%)
Habp2NP_001001505.2 EGF_CA 71..107 CDD:238011
KR 191..275 CDD:238056 0/3 (0%)
Tryp_SPc 312..551 CDD:238113 87/272 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.