DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Tmprss15

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_038944148.1 Gene:Tmprss15 / 288291 RGDID:1311046 Length:1028 Species:Rattus norvegicus


Alignment Length:417 Identity:113/417 - (27%)
Similarity:168/417 - (40%) Gaps:93/417 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CNSVEF--GRGTCIEKKD-CDFYAVDKLMELASKQQCFSRQRPDLVCCPRETN------------ 78
            |...||  ..|.||...: ||.|           |.|  ....|...|.|..|            
  Rat   647 CQDDEFQCKDGNCIPMGNLCDSY-----------QHC--SDGSDEAHCVRFLNGTQSNNGLVQFN 698

  Fly    79 --------IIPPLAPRISN------GTTNATSSTTTLKL----LPRTTPRPPSGIDQLP------ 119
                    ...|...:|||      |..:|.||...|..    ..|....|...:...|      
  Rat   699 IHNIWHIACAEPWTTQISNEVCHLLGLGSANSSMPILSTGGGPFVRLNEAPNGSLILTPSLQCSQ 763

  Fly   120 --------EHPYCGSAF-----SFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRW 171
                    .|..||...     ..::|||.:|....:||...|.|...||.: ..||||.::..|
  Rat   764 DSLILLQCNHKSCGEKMVTQKVGPKIVGGSDTQAGAWPWVVALYYRDRSGDR-LLCGASLVSSDW 827

  Fly   172 LLTAAHCIHTMGRNLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYR 236
            |::||||::.  |||...   .|........:::|.     :|..:|..:|||:.:..|.:....
  Rat   828 LVSAAHCVYR--RNLDPT---RWTAVLGLHMQSNLT-----SPQVVRRVVDRIVINPHYDKRRKV 882

  Fly   237 NDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWG--KTESSGSSKIKQKAML 299
            ||||::.|...||:...  ::|:|||.:...:.   .|....::|||  |..:..:..:.::|.:
  Rat   883 NDIAMMHLEFKVNYTDY--IQPICLPEENQTFT---PGRMCSIAGWGYNKINAGSTVDVLKEADV 942

  Fly   300 HIQPQDQCQEAFYKDTKITLADSQMCAG-GEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVS 363
            .:...::||:..   .:..:.:|.:||| .|.|.|||.|||||||..:.|    ||: :|.||.|
  Rat   943 PLVSNEKCQQQL---PEYDITESMLCAGYEEGGTDSCQGDSGGPLMCQEN----NRW-FLVGVTS 999

  Fly   364 IGRKHCGTALFSGIYTRVSSYMDWIES 390
            .| ..|......|:|.|||.:::||.|
  Rat  1000 FG-VQCALPNHPGVYARVSQFIEWIHS 1025

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 12/47 (26%)
Tryp_SPc 131..388 CDD:214473 80/259 (31%)
Tryp_SPc 133..391 CDD:238113 83/261 (32%)
Tmprss15XP_038944148.1 SEA 54..155 CDD:214554
LDLa 188..221 CDD:238060
CUB 229..335 CDD:412131
MAM 351..507 CDD:395504
CUB 528..635 CDD:395345
LDLa 647..681 CDD:238060 12/46 (26%)
Tryp_SPc 789..1025 CDD:238113 82/260 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.