DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Prss38

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:353 Identity:89/353 - (25%)
Similarity:139/353 - (39%) Gaps:80/353 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 IPPLAPRISNGTTNATSSTT-----------------TLKLLPRTTPRPPSGIDQLP-EHPY--- 123
            :.|::.|......|:.||..                 |..|.|  .|.||....:.| .||:   
  Rat    26 VTPVSHRHPKSQPNSLSSDVGRPLSQGLGSDPFSLDGTSALSP--GPAPPHSNIRCPFLHPWPPL 88

  Fly   124 ----------------CGS-AFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRW 171
                            ||. |...:|:||..|...::||...:.|...     :.||.|.:...|
  Rat    89 LWCGREPSLHLFLSSACGQPALHGKLLGGELTIDRKWPWQVSIHYAGF-----HVCGGSILNAYW 148

  Fly   172 LLTAAHCIHTMGRNLTAAI-LGEWNRDTDPDCENDLNGVRECAPPHIR-VTIDRILPHAQYSELN 234
            :||||||.....|..|..: :|..|              .|.|..|.: ..|::::.|..:...:
  Rat   149 VLTAAHCFAREKRLQTFDMYVGITN--------------LEVANKHTQWFEINQVIIHPTFEMFH 199

  Fly   235 -YRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSG-SSKIKQKA 297
             ...|:||::....:  :....:.|:|||...    ..|:..:...:|||.....| :.|...:|
  Rat   200 PVGGDVALVQSKSAI--VFSDYVLPICLPSSN----LNLSDLSCWTTGWGMVSPQGETGKDLLEA 258

  Fly   298 MLHIQPQDQCQEAFYKDTKITLADSQMCAGGEIGVDS-CSGDSGGPLTVEANTASGNRYVYL-AG 360
            .|.:.|:.||| ..|..|...|.: .:|||....:.: |.||||.||..:.|      ..:| .|
  Rat   259 QLPLIPKFQCQ-LLYGLTSYLLPE-MLCAGDIKNMKNVCEGDSGSPLVCKVN------QTWLQIG 315

  Fly   361 VVSIGRKHCGTALFSGIYTRVSSYMDWI 388
            :||.|| .|...|:.|::..||.:::||
  Rat   316 IVSWGR-GCAQPLYPGVFANVSYFLNWI 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 70/262 (27%)
Tryp_SPc 133..391 CDD:238113 71/262 (27%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 71/261 (27%)
Tryp_SPc 116..342 CDD:214473 69/259 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.