DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and KLK9

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_036447.1 Gene:KLK9 / 284366 HGNCID:6370 Length:250 Species:Homo sapiens


Alignment Length:278 Identity:83/278 - (29%)
Similarity:109/278 - (39%) Gaps:73/278 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGE-- 193
            |.:|.........||...|.:.|     ...|||:.|:.|||||||||    .:......|||  
Human    22 RAIGAEECRPNSQPWQAGLFHLT-----RLFCGATLISDRWLLTAAHC----RKPYLWVRLGEHH 77

  Fly   194 -WNRDTDPDCENDLNGVRECAPPHI-RVTIDRILPHAQY----SELNYRNDIALLRLSRPVNW-- 250
             |..:               .|..: |||  ...||..:    |..::.:||.|:||.|....  
Human    78 LWKWE---------------GPEQLFRVT--DFFPHPGFNKDLSANDHNDDIMLIRLPRQARLSP 125

  Fly   251 -LQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEAFYKD 314
             :|..||...|:.|          |....:||||...|       .||:..:..  ||......:
Human   126 AVQPLNLSQTCVSP----------GMQCLISGWGAVSS-------PKALFPVTL--QCANISILE 171

  Fly   315 TKIT-------LADSQMCAG-GEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGT 371
            .|:.       ::||.:||| .|.|..||.|||||||.....         ||||||.|.:.|..
Human   172 NKLCHWAYPGHISDSMLCAGLWEGGRGSCQGDSGGPLVCNGT---------LAGVVSGGAEPCSR 227

  Fly   372 ALFSGIYTRVSSYMDWIE 389
            .....:||.|..|:|||:
Human   228 PRRPAVYTSVCHYLDWIQ 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 81/275 (29%)
Tryp_SPc 133..391 CDD:238113 82/276 (30%)
KLK9NP_036447.1 Tryp_SPc 24..247 CDD:238113 82/276 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.