DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG18636

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:288 Identity:89/288 - (30%)
Similarity:131/288 - (45%) Gaps:44/288 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 SGIDQLPEHPYCG----SAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLL 173
            ||..|..: |.||    |..::|::.||.......||...|...|    ..:.||.|.|..:.:|
  Fly    23 SGCSQFLD-PACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTT----DMFVCGGSLITDKLVL 82

  Fly   174 TAAHCI----HTMGRNLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELN 234
            |||||.    |.:.|      |||:.|....:|.......||   .|:   :|....|..|....
  Fly    83 TAAHCFIANQHLVAR------LGEYERTRSEECTGYYCNFRE---EHM---VDAGFKHKLYDPNT 135

  Fly   235 YRNDIALLRLSRPVNWLQMQNLEPVCLP-PQRGR-YANQLAGSAADVSGWGKTESSGSSKIKQKA 297
            :.||||:||||:.|  :...|:.|:|:. ..|.| |.:::  .....:|||||:....|...|..
  Fly   136 HANDIAILRLSKSV--VYRDNIRPICVVWDHRWRHYLDKI--DLLTATGWGKTQMESDSDALQTL 196

  Fly   298 MLHIQPQDQCQEAFYKDTKITLADSQMCAGGEIGVDS--CSGDSGGPLTVEANTASGNRYVYLAG 360
            .:..||.|.|.:...:    |:|.:|.|||   ..||  |:|||||||.......:..|:|.: |
  Fly   197 DIRRQPPDVCAKFIGQ----TIAGNQFCAG---NWDSNLCNGDSGGPLGAVITHKNTQRFVQV-G 253

  Fly   361 VVSIGRKHCGTALFSGIYTRVSSYMDWI 388
            :.|...::|..|   .::|.|.|:.::|
  Fly   254 IASYTNRNCQKA---SVFTDVLSHAEFI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 81/264 (31%)
Tryp_SPc 133..391 CDD:238113 81/264 (31%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 81/264 (31%)
Tryp_SPc 45..278 CDD:238113 80/263 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.