DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG33459

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster


Alignment Length:278 Identity:87/278 - (31%)
Similarity:124/278 - (44%) Gaps:37/278 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 PYCGS-AFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRN 185
            |.||. .|..|:.||.:.||...||...|....     .:.||.|.|...::||||||:....:|
  Fly    27 PNCGQIPFRMRIFGGMDAGLVSTPWMAFLHNHL-----QFLCGGSLITSEFVLTAAHCVMPTPKN 86

  Fly   186 LTAAILGE--WNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPV 248
            ||.. |||  |.|..|     .:|....    |....:.||..|..|..: ...|||||:|::.|
  Fly    87 LTVR-LGEYDWTRQMD-----SINPKHR----HREYMVTRIYTHPSYRSI-AAYDIALLKLNQTV 140

  Fly   249 NWLQMQNLEPVCLP-PQRGRYANQLAGSAAD--VSGWGKTESSGSSKIKQKAMLHIQPQDQCQEA 310
            .:...  :.|:||. |:.......|..|..|  ::|||.|::...|::.|.|.|....:..|.:.
  Fly   141 EYTVA--IRPICLVLPENFHEWYWLVDSVEDFTLTGWGATKTEPVSQVLQSANLTQIDRGTCHDR 203

  Fly   311 FYKDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYL-AGVVSIGRKHC-GTAL 373
            :......|    .:|||..... :|.||||.||.::  .....||::. .|:||.|.|:| |..:
  Fly   204 YGHSVDHT----HICAGSSKSF-ACVGDSGSPLAMK--VVHNRRYIHAQVGIVSRGPKNCDGVTV 261

  Fly   374 FSGIYTRVSSYMDWIEST 391
            |    |.|.|:.:||..|
  Fly   262 F----TNVVSFTEWIFRT 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 80/263 (30%)
Tryp_SPc 133..391 CDD:238113 81/264 (31%)
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 80/263 (30%)
Tryp_SPc 38..272 CDD:238113 79/262 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.