DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Prss45

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_694812.1 Gene:Prss45 / 260408 MGIID:3605764 Length:317 Species:Mus musculus


Alignment Length:312 Identity:87/312 - (27%)
Similarity:134/312 - (42%) Gaps:67/312 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 LKLLPRTTPRPPSGIDQLPEHPYCGSA-FSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGA 164
            |.|||   |||..|.::....|.||:. :...|...|:     :||...|:.|     ..:.||.
Mouse    26 LLLLP---PRPNLGYNENYTEPVCGTPWWPDNLEESHH-----WPWEASLQIE-----DKHVCGG 77

  Fly   165 SFIAQRWLLTAAHCIHTMGRNLTAAILG---------EWNRDTDPDCENDLNGVRECAPPHIRVT 220
            :.|.:.|:::|||||  .|....:.:||         .|.                     :::.
Mouse    78 ALIDRSWVVSAAHCI--QGNKEYSVMLGSSTLHPNGSSWT---------------------LKIP 119

  Fly   221 IDRILPHAQYSELNY-RNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGK 284
            :..|:.|.:|...|: |:|||||.|..||.:  .:.::|:|||...   .|...|:...|:|||:
Mouse   120 VGDIIIHPKYWGRNFIRSDIALLCLETPVTF--NKYVQPICLPEHN---FNFKVGTKCWVTGWGQ 179

  Fly   285 TESSGSSKIKQ-----KAMLHIQPQDQCQEAFYKDT----KITLADSQMCAGGEIGVDSCSGDSG 340
            .:...|:::..     :|.:.|.....|...|:|.|    .:.|....|......|.|.|.||.|
Mouse   180 VKQHSSAQLTPAPELWEAEVFIIDNKNCDSIFHKKTLYPQVVPLIRKNMICTTNYGEDLCYGDPG 244

  Fly   341 GPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIESTI 392
            |||..|.:    .|:: ||||.| ..|.|.|.....:|||::.|..||:..:
Mouse   245 GPLACEID----GRWI-LAGVFS-WEKACATVPNLSVYTRITKYTIWIKDQV 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 74/275 (27%)
Tryp_SPc 133..391 CDD:238113 75/276 (27%)
Prss45NP_694812.1 Tryp_SPc 59..289 CDD:238113 75/273 (27%)
Tryp_SPc 59..286 CDD:214473 73/270 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.