DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Prss1

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_036767.1 Gene:Prss1 / 24691 RGDID:3417 Length:246 Species:Rattus norvegicus


Alignment Length:282 Identity:87/282 - (30%)
Similarity:126/282 - (44%) Gaps:57/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 GSAFSF------RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMG 183
            |:|.:|      ::|||:.......|:...|.    ||  .:.||.|.|..:|:::||||.    
  Rat    11 GAAVAFPLEDDDKIVGGYTCPEHSVPYQVSLN----SG--YHFCGGSLINDQWVVSAAHCY---- 65

  Fly   184 RNLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPV 248
            ::.....|||.|.:.....|..:|..             :|:.|..||.....|||.|::||.||
  Rat    66 KSRIQVRLGEHNINVLEGDEQFINAA-------------KIIKHPNYSSWTLNNDIMLIKLSSPV 117

  Fly   249 NWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSG--SSKIKQKAMLHIQPQDQCQEAF 311
            .  ....:.||.||.     |...||:...:||||.|.|:|  :..:.|.....:..|..|:.|:
  Rat   118 K--LNARVAPVALPS-----ACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAY 175

  Fly   312 YKDTKITLADSQMCAGG-EIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTAL-- 373
            ..:    :..|.:|.|. |.|.|||.||||||:.....         |.|:||.|   .|.||  
  Rat   176 PGE----ITSSMICVGFLEGGKDSCQGDSGGPVVCNGQ---------LQGIVSWG---YGCALPD 224

  Fly   374 FSGIYTRVSSYMDWIESTIRAN 395
            ..|:||:|.:::.||:.||.||
  Rat   225 NPGVYTKVCNFVGWIQDTIAAN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 78/261 (30%)
Tryp_SPc 133..391 CDD:238113 80/262 (31%)
Prss1NP_036767.1 Tryp_SPc 23..239 CDD:214473 78/261 (30%)
Tryp_SPc 24..242 CDD:238113 80/263 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.