DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG30375

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_724665.1 Gene:CG30375 / 246575 FlyBaseID:FBgn0050375 Length:398 Species:Drosophila melanogaster


Alignment Length:326 Identity:99/326 - (30%)
Similarity:143/326 - (43%) Gaps:68/326 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 RISNGTTNA----TSSTTTLKLLPRTTPRP---------PSGIDQLPEHPYCGSAFSFRLVGGHN 137
            ||||..|.|    :||       |:|..|.         |:..|       ||.:|..|:..|..
  Fly   107 RISNFQTMAFAYYSSS-------PQTQQRSRLNCQAVARPAPCD-------CGWSFPNRIANGVE 157

  Fly   138 TGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTA----AILGEWNRDT 198
            .|..|||  :::....:|......||.|.:::|:::|||||   ..|...|    |::||.:..|
  Fly   158 AGKHEFP--SMVGLRDLSSNLPIFCGGSIVSERYIMTAAHC---TARQPVASRLLALVGEHDLST 217

  Fly   199 DPDCENDLNGVRECAPPHIRVTIDRILPHAQYSEL--NYRNDIALLRLSRPVNWLQMQNLEPVCL 261
                     |.........|  |..|:.|..|.|.  ...||||||:.:.|:.|  .:.:.|:||
  Fly   218 ---------GAESIYAAQYR--IQNIINHPGYMETASGNINDIALLQTATPIEW--SRGVAPICL 269

  Fly   262 PPQRGRYANQLAGSAADVSGWGKTESSGS-SKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQMC 325
            |.::..  |.......|:.|||....:.| |...|||.|.......|:..|  ::.||  .|.:|
  Fly   270 PIRQAE--NSFNYQNVDIMGWGTLGFAASKSNTLQKATLLTMDNAVCRSRF--NSSIT--PSHLC 328

  Fly   326 ---AGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDW 387
               |||. |.|||..|||||:.:..     ...::..||:|.||. ||.....|:.|||:|:::|
  Fly   329 TYDAGGR-GQDSCQYDSGGPVILRQ-----RERMFQLGVISYGRA-CGQPFGIGVNTRVTSHLNW 386

  Fly   388 I 388
            :
  Fly   387 L 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 82/266 (31%)
Tryp_SPc 133..391 CDD:238113 82/266 (31%)
CG30375NP_724665.1 CUB 38..>100 CDD:294042
Tryp_SPc 151..386 CDD:214473 82/265 (31%)
Tryp_SPc 152..387 CDD:238113 81/265 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455915
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.