DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG30098

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:306 Identity:85/306 - (27%)
Similarity:126/306 - (41%) Gaps:87/306 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 GIDQLPEHPYCGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHC 178
            |..||.:.. |.:.|..|::||.|..  ..||...|..:     ..:|||.|.||.|::||||||
  Fly    20 GYSQLLDSK-CIALFRIRVIGGQNAR--RTPWMAYLIRD-----NRFACGGSLIAYRFVLTAAHC 76

  Fly   179 IHTMGRNLTAAILGEW--NRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRN-DIA 240
            . .:..||... |||:  :|.||....:            .||.  .|..|..|  :::|| |||
  Fly    77 T-KINDNLFVR-LGEYDSSRTTDGQTRS------------YRVV--SIYRHKNY--IDFRNHDIA 123

  Fly   241 LLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAAD--VSGWGKTESSGSSKIKQKAMLHIQP 303
            :|:|.|.|  :....:.|:|:....|  ...||.|..:  ::|||:             |.|   
  Fly   124 VLKLDRQV--VYDAYIRPICILLNSG--LQSLANSIQNFTLTGWGQ-------------MAH--- 168

  Fly   304 QDQCQEAFYK------DTKITLADSQMCAGGEIGVDS------------CSGDSGGPLTVEANTA 350
                   :||      :..:....::.|     ||.|            |.|||||||  .:...
  Fly   169 -------YYKMPTTLQEMSLRRVRNEYC-----GVPSLSICCWNPVQYACFGDSGGPL--GSLVK 219

  Fly   351 SGNRYVYLA-GVVSIGRKHCGTALFSGIYTRVSSYMDWIESTIRAN 395
            .|::.:|:. ||.:....:|..  :|. |..:.|||.|:..|:..|
  Fly   220 YGHKTIYVQFGVTNSVTGNCDG--YSS-YLDLMSYMPWLYQTLLRN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 77/280 (28%)
Tryp_SPc 133..391 CDD:238113 77/281 (27%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 77/279 (28%)
Tryp_SPc 37..258 CDD:238113 77/282 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.