DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG30002

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001163100.1 Gene:CG30002 / 246384 FlyBaseID:FBgn0260474 Length:311 Species:Drosophila melanogaster


Alignment Length:262 Identity:87/262 - (33%)
Similarity:129/262 - (49%) Gaps:23/262 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 FRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAI-LGE 193
            |.:.||..:.|...||...|  ...|..:...||.|.|::.::||||||.....|:....: |||
  Fly    60 FMITGGRKSSLMSQPWMAFL--HIASDLEMCRCGGSLISELFVLTAAHCFKMCPRSKEIRVWLGE 122

  Fly   194 WNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEP 258
            .:..:..|| ...|..|.||||....|||:.:.|.:::......||||::|::.|  :...::.|
  Fly   123 LDLSSTSDC-TTYNYERVCAPPVEEFTIDKWILHEEFNLFYPGYDIALIKLNKKV--VFKDHIRP 184

  Fly   259 VCLP--PQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEAFYKDTKITLAD 321
            :|||  .:...:..|| |......|||||||...:....:..:.   .::|.:.  :||      
  Fly   185 ICLPLTDELLAFTLQL-GQRFMAVGWGKTESLRYANSTMEVDIR---TEKCTDG--RDT------ 237

  Fly   322 SQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMD 386
            |.:||.|:. ||:|:|||||||..:......:|.|.. ||||.|.::|| |.....|..|.:||.
  Fly   238 SFLCASGDY-VDTCNGDSGGPLLWKTTLFGKDRAVQF-GVVSTGSQNCG-AGHKAYYMDVPTYMP 299

  Fly   387 WI 388
            ||
  Fly   300 WI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 84/259 (32%)
Tryp_SPc 133..391 CDD:238113 86/259 (33%)
CG30002NP_001163100.1 Tryp_SPc 62..301 CDD:214473 84/258 (33%)
Tryp_SPc 62..301 CDD:238113 84/258 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455944
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.