DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Tmprss11f

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_848845.1 Gene:Tmprss11f / 243083 MGIID:2442348 Length:439 Species:Mus musculus


Alignment Length:355 Identity:97/355 - (27%)
Similarity:149/355 - (41%) Gaps:76/355 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VDKLMELASKQQCFSRQRPDLVCCPRETNIIPPLAPRISNGTTNATSSTTTLKLLPRTTPRPPSG 114
            :.|.:|....|....:|.|..:..|..:     |.|..|....|..:|...:::.....|.|.|.
Mouse   143 IKKRIERTFYQSLKIKQLPLTISMPSFS-----LTPIDSKKMRNLLNSRCGIRMSSSNIPLPASS 202

  Fly   115 IDQLPEHPYCGSAFSFRLVGGHNTGL-FEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHC 178
            ..:             |:|.|..|.: .|:||...|:..    |..:.|||:.|:..||||||||
Mouse   203 STE-------------RIVQGRETAMEGEWPWQASLQLI----GAGHQCGATLISNTWLLTAAHC 250

  Fly   179 ----------IHTMGRNLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSEL 233
                      |.|.|..:|                          ||.::.::.:|:.|.:|...
Mouse   251 FWKNRDPTKWIVTFGTTIT--------------------------PPLVKRSVGKIIIHEEYHRD 289

  Fly   234 NYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIK-QKA 297
            ...|||||.:|:..|.:..:  ::.||||....:...:   ::..|:|:|.....|.::.| ::|
Mouse   290 TNENDIALAQLTTRVEFSNV--VQRVCLPDSSMKLPPK---TSVFVTGFGSIVDDGPTQNKLRQA 349

  Fly   298 MLHIQPQDQCQEAFYKDTKITLADSQMCAGGEIG-VDSCSGDSGGPLTVEANTASGNRYV-YLAG 360
            .:.....|.|......|..||  ...:|||...| :|:|.|||||||..:      ||.: |:.|
Mouse   350 RVETIGSDVCNRKDVYDGLIT--PGMLCAGFMEGKIDACKGDSGGPLVYD------NRDIWYIVG 406

  Fly   361 VVSIGRKHCGTALFSGIYTRVSSYMDWIES 390
            :||.|:. |......|:||||:.|.|||.|
Mouse   407 IVSWGQS-CALPNKPGVYTRVTKYRDWIAS 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 5/23 (22%)
Tryp_SPc 131..388 CDD:214473 80/270 (30%)
Tryp_SPc 133..391 CDD:238113 82/272 (30%)
Tmprss11fNP_848845.1 SEA 60..164 CDD:396113 5/20 (25%)
Tryp_SPc 207..436 CDD:238113 82/273 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.