DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Ctrb1

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_036668.1 Gene:Ctrb1 / 24291 RGDID:2444 Length:263 Species:Rattus norvegicus


Alignment Length:270 Identity:82/270 - (30%)
Similarity:138/270 - (51%) Gaps:44/270 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMG-RNLTAAILGEW 194
            |:|.|.:.....:||...|:.:|   |..: ||.|.|::.|::|||||    | :.....:.||:
  Rat    33 RIVNGEDAIPGSWPWQVSLQDKT---GFHF-CGGSLISEDWVVTAAHC----GVKTSDVVVAGEF 89

  Fly   195 NRDTDPDCENDLNGVRECAPPHIRV-TIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEP 258
            ::.:|.:              :|:| .|.::..:.:::....||||.||:|:.|..:  .:.:..
  Rat    90 DQGSDEE--------------NIQVLKIAQVFKNPKFNMFTVRNDITLLKLATPAQF--SETVSA 138

  Fly   259 VCLPPQRGRYANQLAGSAADVSGWGKTESSG--SSKIKQKAMLHIQPQDQCQEAFYKDTKITLAD 321
            ||||.....:.   .|:....:|||||:.:.  :.:..|:|.|.|..:..|::::  .:|||  |
  Rat   139 VCLPNVDDDFP---PGTVCATTGWGKTKYNALKTPEKLQQAALPIVSEADCKKSW--GSKIT--D 196

  Fly   322 SQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVY-LAGVVSIGRKHCGTALFSGIYTRVSSYM 385
            ...|||.. ||.||.|||||||..:.:.      |: |||:||.|...|.|:. ..:|:||::.|
  Rat   197 VMTCAGAS-GVSSCMGDSGGPLVCQKDG------VWTLAGIVSWGSGVCSTST-PAVYSRVTALM 253

  Fly   386 DWIESTIRAN 395
            .|::..:.||
  Rat   254 PWVQQILEAN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 79/261 (30%)
Tryp_SPc 133..391 CDD:238113 79/262 (30%)
Ctrb1NP_036668.1 Tryp_SPc 33..256 CDD:214473 79/261 (30%)
Tryp_SPc 34..259 CDD:238113 79/263 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.