DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Tmprss11d

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_663536.1 Gene:Tmprss11d / 231382 MGIID:2385221 Length:417 Species:Mus musculus


Alignment Length:309 Identity:95/309 - (30%)
Similarity:140/309 - (45%) Gaps:50/309 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 LAPRISNGTTNATSSTTTLKLLPRTTPRPPSGIDQLPEHPYCGSAFSFRLVGGHNTGLFEFPWTT 147
            :||  ||..|:.|...|...|......||  .:..|.|.         |::||......::||..
Mouse   150 IAP--SNEITSLTDQDTENVLTQECGARP--DLITLSEE---------RIIGGMQAEPGDWPWQV 201

  Fly   148 LLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNRDTDPDCENDLNGVREC 212
            .|:...|     :.||.:.|:..|:||||||..:.               .:|.......||...
Mouse   202 SLQLNNV-----HHCGGALISNMWVLTAAHCFKSY---------------PNPQYWTATFGVSTM 246

  Fly   213 APPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAA 277
            : |.:||.:..||.|..||.:...||||:::|.|.|.:  .:|:..||||   ....|.:.||.|
Mouse   247 S-PRLRVRVRAILAHDGYSSVTRDNDIAVVQLDRSVAF--SRNIHRVCLP---AATQNIIPGSVA 305

  Fly   278 DVSGWGKTESSGS--SKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQMCAGGEIG-VDSCSGDS 339
            .|:|||.....|:  :.::|..:..|..::....|.|..   ::....:|||...| ||:|.|||
Mouse   306 YVTGWGSLTYGGNAVTNLRQGEVRIISSEECNTPAGYSG---SVLPGMLCAGMRSGAVDACQGDS 367

  Fly   340 GGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWI 388
            ||||..|    ...|..::.|:||.|.: ||.....|:||||::|.:||
Mouse   368 GGPLVQE----DSRRLWFVVGIVSWGYQ-CGLPNKPGVYTRVTAYRNWI 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 81/259 (31%)
Tryp_SPc 133..391 CDD:238113 82/259 (32%)
Tmprss11dNP_663536.1 SEA 48..140 CDD:279699
Tryp_SPc 185..411 CDD:214473 81/259 (31%)
Tryp_SPc 186..414 CDD:238113 82/260 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.