DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Prss47

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_006517555.1 Gene:Prss47 / 218304 MGIID:2685120 Length:370 Species:Mus musculus


Alignment Length:334 Identity:87/334 - (26%)
Similarity:147/334 - (44%) Gaps:57/334 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 IIPPLAPRISNGTTNATSSTTTLKLLPRTTPRPPSGIDQLP-EHPYCGS-AFSFRLVGGHNTGLF 141
            ::.|:.|.|.|  .:..|.....:..|:....|.:..:|.| ..|.||. ....::.||.:|...
Mouse    21 LLLPIKPSIPN--ASKVSGIAPGRPQPQQGWEPSASRNQYPVNRPVCGKPKMVGKVFGGQDTLAG 83

  Fly   142 EFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAA------ILGEWNRDTDP 200
            ::||...|.|..|     :.|||..|...||.:.|||.    ||.:.|      :||.       
Mouse    84 QWPWQASLLYRGV-----HLCGAVLIDTHWLASTAHCF----RNKSQAPEDYEVLLGN------- 132

  Fly   201 DCENDLNGVRECAPPHIRVTIDRILPHAQYSEL-NYRNDIALLRLSRPVNWLQMQNLEPVCLPPQ 264
                  |.:.:......:::::.|:.|..:.:. ::.:|||:|:|..|:|:...  :.|.|||.:
Mouse   133 ------NQLYQETKHTQKISVNHIVSHPDFEKFHSFGSDIAMLQLHLPINFTSY--VVPACLPSK 189

  Fly   265 RGRYANQLAGSAADVSGWGKTESSGSSKI-----KQKAMLHIQPQDQCQEAFYKDT----KITLA 320
            ..:.:|.   ::..::|||..  |..:|:     .|:..:.|...:.| .|.|..|    :..:.
Mouse   190 DTQLSNH---TSCWITGWGML--SEDTKLLPPFSLQEGEVGIIDNEFC-NALYGQTPGQSRNYVY 248

  Fly   321 DSQMCAGG-EIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSY 384
            :..:|||| ..|...|.|||||||....|:.    :| |.|:.|.| ..|...::..::|||:.:
Mouse   249 EEMLCAGGLSTGKSICRGDSGGPLICYHNST----WV-LVGLASWG-LDCRHPIYPSVFTRVAYF 307

  Fly   385 MDWIESTIR 393
            .|||....|
Mouse   308 TDWISQVKR 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 72/273 (26%)
Tryp_SPc 133..391 CDD:238113 74/274 (27%)
Prss47XP_006517555.1 Tryp_SPc 74..314 CDD:238113 74/275 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.