DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and F10

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_000495.1 Gene:F10 / 2159 HGNCID:3528 Length:488 Species:Homo sapiens


Alignment Length:405 Identity:105/405 - (25%)
Similarity:171/405 - (42%) Gaps:74/405 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GNCNSVEFGRGTC-----IEKKDCDFYAVDKLMELAS---KQQCFSRQRPDLVCCPRETNIIP-- 81
            |.|.. ..|..||     .|.|:|:.: ..||..|.:   .|.|...|...:..|.|...:..  
Human    99 GKCKD-GLGEYTCTCLEGFEGKNCELF-TRKLCSLDNGDCDQFCHEEQNSVVCSCARGYTLADNG 161

  Fly    82 ----PLAP---------RISNGTTNATSS------TTTLK------LLPRTTPRPPSGIDQLPEH 121
                |..|         |.......||||      :.|.|      |.|  |..|...:|.....
Human   162 KACIPTGPYPCGKQTLERRKRSVAQATSSSGEAPDSITWKPYDAADLDP--TENPFDLLDFNQTQ 224

  Fly   122 PYCGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNL 186
            |..|.....|:|||......|.||..||..|...|    .||.:.:::.::||||||::...|  
Human   225 PERGDNNLTRIVGGQECKDGECPWQALLINEENEG----FCGGTILSEFYILTAAHCLYQAKR-- 283

  Fly   187 TAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWL 251
            ....:|:.|.:.:...|    .|.|         ::.::.|.::::..|..|||:|||..|:.: 
Human   284 FKVRVGDRNTEQEEGGE----AVHE---------VEVVIKHNRFTKETYDFDIAVLRLKTPITF- 334

  Fly   252 QMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSG--SSKIKQKAMLHIQPQDQCQEAFYKD 314
             ..|:.|.|||.:....:..:......|||:|:|...|  |:::|...:.::. ::.|:    ..
Human   335 -RMNVAPACLPERDWAESTLMTQKTGIVSGFGRTHEKGRQSTRLKMLEVPYVD-RNSCK----LS 393

  Fly   315 TKITLADSQMCAGGEI-GVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIY 378
            :...:..:..|||.:. ..|:|.||||||..    |...:.| ::.|:||.| :.|......|||
Human   394 SSFIITQNMFCAGYDTKQEDACQGDSGGPHV----TRFKDTY-FVTGIVSWG-EGCARKGKYGIY 452

  Fly   379 TRVSSYMDWIESTIR 393
            |:|::::.||:.:::
Human   453 TKVTAFLKWIDRSMK 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 13/52 (25%)
Tryp_SPc 131..388 CDD:214473 71/259 (27%)
Tryp_SPc 133..391 CDD:238113 72/260 (28%)
F10NP_000495.1 GLA 25..85 CDD:214503
EGF_CA 86..122 CDD:238011 7/23 (30%)
FXa_inhibition 129..164 CDD:317114 6/34 (18%)
O-glycosylated at one site 183..203 6/19 (32%)
Tryp_SPc 235..464 CDD:238113 72/260 (28%)
O-glycosylated at one site 476..485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.