DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Tmprss4

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_663378.1 Gene:Tmprss4 / 214523 MGIID:2384877 Length:435 Species:Mus musculus


Alignment Length:373 Identity:94/373 - (25%)
Similarity:154/373 - (41%) Gaps:111/373 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DKLMELASKQQCFSRQ--------RPDLVCCPRETNIIPPLAP--------RISNGTTNATS-ST 98
            :.|.:.|.:|..:..|        |||       .|:  |:|.        ::.||:.:..| |.
Mouse   131 EALAKTACRQMGYDSQPAFRAVEIRPD-------QNL--PVAQVTGNSQELQVQNGSRSCLSGSL 186

  Fly    99 TTLKLLPRTTPRPPSGIDQLPEHPYCGSAFSF-RLVGGHNTGLFEFPWTTLLEYETVSGGKDYAC 162
            .:|:.|.                  ||.:... |:|||....:..:||...::|     .|.:.|
Mouse   187 VSLRCLD------------------CGKSLKTPRVVGGVEAPVDSWPWQVSIQY-----NKQHVC 228

  Fly   163 GASFIAQRWLLTAAHCIH----------TMGRNLTAAILGEWNRDTDPDCENDLNGVRECAP--P 215
            |.|.:...|:||||||..          ..|.|    |||.                   :|  |
Mouse   229 GGSILDPHWILTAAHCFRKYLDVSSWKVRAGSN----ILGN-------------------SPSLP 270

  Fly   216 HIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAAD-- 278
            ..::.|..  |:..|.:   ..||||::|..|:.:  ..::.|:|||     :::::...|..  
Mouse   271 VAKIFIAE--PNPLYPK---EKDIALVKLQMPLTF--SGSVRPICLP-----FSDEVLVPATPVW 323

  Fly   279 VSGWGKTESSGS--SKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQMCAG-GEIGVDSCSGDSG 340
            |.|||.||.:|.  |.:..:|.:.:....:|......:.::|.  ..:||| .:.|.|:|.||||
Mouse   324 VIGWGFTEENGGKMSDMLLQASVQVIDSTRCNAEDAYEGEVTA--EMLCAGTPQGGKDTCQGDSG 386

  Fly   341 GPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWI 388
            |||...::...      :.|:||.|. .||.....|:||:|::|::||
Mouse   387 GPLMYHSDKWQ------VVGIVSWGH-GCGGPSTPGVYTKVTAYLNWI 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 7/30 (23%)
Tryp_SPc 131..388 CDD:214473 74/273 (27%)
Tryp_SPc 133..391 CDD:238113 75/273 (27%)
Tmprss4NP_663378.1 LDLa 56..90 CDD:238060
SRCR_2 106..195 CDD:295335 16/90 (18%)
Tryp_SPc 202..427 CDD:214473 74/273 (27%)
Tryp_SPc 203..430 CDD:238113 75/274 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.