DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Prss27

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_780649.1 Gene:Prss27 / 213171 MGIID:2450123 Length:328 Species:Mus musculus


Alignment Length:280 Identity:82/280 - (29%)
Similarity:127/280 - (45%) Gaps:40/280 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CGSAFSF-RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCI-HTMGRNL 186
            ||....| |:|||.|....|:||...::...:     :.||.|.||..|:||||||. :|...::
Mouse    29 CGHPKMFNRMVGGENALEGEWPWQVSIQRNGI-----HFCGGSLIAPTWVLTAAHCFSNTSDISI 88

  Fly   187 TAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWL 251
            ...:||...             :::..|..:.|.:.::..:.||..:....|:||:.|..||.:.
Mouse    89 YQVLLGALK-------------LQQPGPHALYVPVKQVKSNPQYQGMASSADVALVELQGPVTFT 140

  Fly   252 QMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSG---SSKIKQKAMLHIQPQDQCQEAFYK 313
            ..  :.|||||.....:.   :|....|:|||......   :.::.||..:.|....:|...:.|
Mouse   141 NY--ILPVCLPDPSVIFE---SGMNCWVTGWGSPSEQDRLPNPRVLQKLAVPIIDTPKCNLLYNK 200

  Fly   314 DTKI-----TLADSQMCAG-GEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTA 372
            |.:.     |:.|..:||| .|...|:|.|||||||....:.:    :|. |||:|.| :.|...
Mouse   201 DVESDFQLKTIKDDMLCAGFAEGKKDACKGDSGGPLVCLVDQS----WVQ-AGVISWG-EGCARR 259

  Fly   373 LFSGIYTRVSSYMDWIESTI 392
            ...|:|.||:|:..||...|
Mouse   260 NRPGVYIRVTSHHKWIHQII 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 76/266 (29%)
Tryp_SPc 133..391 CDD:238113 77/267 (29%)
Prss27NP_780649.1 Tryp_SPc 37..275 CDD:214473 76/266 (29%)
Tryp_SPc 39..278 CDD:238113 77/267 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.