DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Tmprss15

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_032967.1 Gene:Tmprss15 / 19146 MGIID:1197523 Length:1069 Species:Mus musculus


Alignment Length:424 Identity:110/424 - (25%)
Similarity:171/424 - (40%) Gaps:107/424 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CNSVEF--GRGTCIEKKD-CDFYAVDKLMELASKQQCFSRQRPDLVCCPRETNIIPPLAPRISNG 90
            |...||  ..|.||...: ||.|           ..|  |...|...|.|..|     ..|.:||
Mouse   688 CQDDEFQCKDGNCIPLGNLCDSY-----------PHC--RDGSDEASCVRFLN-----GTRSNNG 734

  Fly    91 ------------------TTNATS---------STTTLKLLPRTTPRPPSGIDQLP--------- 119
                              ||..::         |..:...:..|...|...::|.|         
Mouse   735 LVQFNIHSIWHIACAENWTTQISNEVCHLLGLGSANSSMPISSTGGGPFVRVNQAPNGSLILTPS 799

  Fly   120 -------------EHPYCG-----SAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASF 166
                         .|..||     ...|.::|||.:.....:||...|.:...|..: ..||||.
Mouse   800 LQCSQDSLILLQCNHKSCGEKKVTQKVSPKIVGGSDAQAGAWPWVVALYHRDRSTDR-LLCGASL 863

  Fly   167 IAQRWLLTAAHCIHTMGRNLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYS 231
            ::..||::||||::.  |||...   .|........:::|.     :|..:|..:|:|:.:..|.
Mouse   864 VSSDWLVSAAHCVYR--RNLDPT---RWTAVLGLHMQSNLT-----SPQVVRRVVDQIVINPHYD 918

  Fly   232 ELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQ--LAGSAADVSGWG--KTESSGSSK 292
            .....||||::.|...||:...  ::|:|||.:     ||  :.|....::|||  |..:..:..
Mouse   919 RRRKVNDIAMMHLEFKVNYTDY--IQPICLPEE-----NQIFIPGRTCSIAGWGYDKINAGSTVD 976

  Fly   293 IKQKAMLHIQPQDQCQEAFYKDTKITLADSQMCAG-GEIGVDSCSGDSGGPLTVEANTASGNRYV 356
            :.::|.:.:...::||:..   .:..:.:|.:||| .|.|:|||.|||||||..:.|    ||: 
Mouse   977 VLKEADVPLISNEKCQQQL---PEYNITESMICAGYEEGGIDSCQGDSGGPLMCQEN----NRW- 1033

  Fly   357 YLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIES 390
            :|.||.|.| ..|......|:|.|||.:::||.|
Mouse  1034 FLVGVTSFG-VQCALPNHPGVYVRVSQFIEWIHS 1066

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 12/47 (26%)
Tryp_SPc 131..388 CDD:214473 78/261 (30%)
Tryp_SPc 133..391 CDD:238113 81/263 (31%)
Tmprss15NP_032967.1 SEA 53..154 CDD:214554
LDLa 228..261 CDD:197566
CUB 270..376 CDD:294042
MAM 392..549 CDD:279023
MAM 392..547 CDD:99706
CUB 569..676 CDD:278839
LDLa 688..722 CDD:238060 12/46 (26%)
SR 723..816 CDD:214555 13/97 (13%)
SRCR 728..819 CDD:278931 12/90 (13%)
Tryp_SPc 829..1064 CDD:214473 78/261 (30%)
Tryp_SPc 830..1066 CDD:238113 80/262 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.