DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Proc

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_006525784.1 Gene:Proc / 19123 MGIID:97771 Length:484 Species:Mus musculus


Alignment Length:410 Identity:117/410 - (28%)
Similarity:161/410 - (39%) Gaps:107/410 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CNSVEFGRGTCIE-----KKDCDFYAVDKLMELASK-QQCFSRQRPDLVCCPRETNIIPPLAPRI 87
            |:|...|.||||:     ...||.....|..:...: |.|.......|..|..|           
Mouse   124 CDSPCCGHGTCIDGIGSFSCSCDKGWEGKFCQQELRFQDCRVNNGGCLHYCLEE----------- 177

  Fly    88 SNGTTNATS-------------STTTL-------------KLLPRTTPRPPSGIDQLPEHPYCGS 126
            |||...|.:             ||...             |:|.|.|...    |:|...|    
Mouse   178 SNGRRCACAPGYELADDHMRCKSTVNFPCGKLGRWIEKKRKILKRDTDLE----DELEPDP---- 234

  Fly   127 AFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAIL 191
                |:|.|..|...:.||..:|    :...|..|||...|...|:||||||:.  |.......|
Mouse   235 ----RIVNGTLTKQGDSPWQAIL----LDSKKKLACGGVLIHTSWVLTAAHCVE--GTKKLTVRL 289

  Fly   192 GEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNL 256
            ||::.......|.||:             |..||.|..|:..:..||||||||::|..  ..:.:
Mouse   290 GEYDLRRRDHWELDLD-------------IKEILVHPNYTRSSSDNDIALLRLAQPAT--LSKTI 339

  Fly   257 EPVCLPPQRGRYANQL--AGSAADVSGWGKTESSGSSKIKQK----------AMLHIQPQDQCQE 309
            .|:|||  ....|.:|  ||....|:|||..    |.:||..          ..:.:..:::|.|
Mouse   340 VPICLP--NNGLAQELTQAGQETVVTGWGYQ----SDRIKDGRRNRTFILTFIRIPLVARNECVE 398

  Fly   310 AFYKDTKITLADSQMCAG--GEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTA 372
            ..    |..::::.:|||  |:.. |:|.||||||:.|.....     .:|.|:||.| :.||..
Mouse   399 VM----KNVVSENMLCAGIIGDTR-DACDGDSGGPMVVFFRGT-----WFLVGLVSWG-EGCGHT 452

  Fly   373 LFSGIYTRVSSYMDWIESTI 392
            ...||||:|.||:.||.|.|
Mouse   453 NNYGIYTKVGSYLKWIHSYI 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 13/50 (26%)
Tryp_SPc 131..388 CDD:214473 85/270 (31%)
Tryp_SPc 133..391 CDD:238113 86/271 (32%)
ProcXP_006525784.1 GLA 50..110 CDD:214503
EGF_CA 111..155 CDD:238011 10/30 (33%)
FXa_inhibition 163..198 CDD:373209 8/45 (18%)
Tryp_SPc 236..470 CDD:238113 86/271 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.