DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Plg

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_032903.3 Gene:Plg / 18815 MGIID:97620 Length:812 Species:Mus musculus


Alignment Length:363 Identity:106/363 - (29%)
Similarity:155/363 - (42%) Gaps:98/363 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 GTTNATSSTTTLK------------LLPRTTPRP---------PSGIDQLP-------------- 119
            |.|..|::.|..:            ..|:|.||.         |.|....|              
Mouse   491 GKTAVTAAGTPCQGWAAQEPHRHSIFTPQTNPRAGLEKNYCRNPDGDVNGPWCYTTNPRKLYDYC 555

  Fly   120 EHPYCGSAFSF--------------RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQR 170
            :.|.|.||.||              |:|||.......:||.  :...|...|:.: ||.:.||..
Mouse   556 DIPLCASASSFECGKPQVEPKKCPGRVVGGCVANPHSWPWQ--ISLRTRFTGQHF-CGGTLIAPE 617

  Fly   171 WLLTAAHCIHTMGR-NLTAAILG---EWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYS 231
            |:||||||:....| .....|||   |:.|..|         |:|       :::.:::     .
Mouse   618 WVLTAAHCLEKSSRPEFYKVILGAHEEYIRGLD---------VQE-------ISVAKLI-----L 661

  Fly   232 ELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESS-GSSKIKQ 295
            |.|.| |||||:||||..  ....:.|.|||......|::   :...::|||:|:.: |:.::|:
Mouse   662 EPNNR-DIALLKLSRPAT--ITDKVIPACLPSPNYMVADR---TICYITGWGETQGTFGAGRLKE 720

  Fly   296 KAMLHIQPQDQCQEAFYKDTKITLADSQMCAG---GEIGVDSCSGDSGGPLTVEANTASGNRYVY 357
             |.|.:.....|....|.:.::  ..:::|||   |  |||||.|||||||.    ....::|: 
Mouse   721 -AQLPVIENKVCNRVEYLNNRV--KSTELCAGQLAG--GVDSCQGDSGGPLV----CFEKDKYI- 775

  Fly   358 LAGVVSIGRKHCGTALFSGIYTRVSSYMDWIESTIRAN 395
            |.||.|.| ..|......|:|.|||.::||||..:|.|
Mouse   776 LQGVTSWG-LGCARPNKPGVYVRVSRFVDWIEREMRNN 812

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 84/264 (32%)
Tryp_SPc 133..391 CDD:238113 86/265 (32%)
PlgNP_032903.3 PAN_AP_HGF <38..97 CDD:238532
KR 101..183 CDD:214527
KR 183..262 CDD:214527
KR 273..354 CDD:214527
KR 375..456 CDD:214527
KR 480..562 CDD:214527 13/70 (19%)
Tryp_SPc 581..805 CDD:214473 84/264 (32%)
Tryp_SPc 582..807 CDD:238113 85/265 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.