DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Plau

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_032899.1 Gene:Plau / 18792 MGIID:97611 Length:433 Species:Mus musculus


Alignment Length:303 Identity:90/303 - (29%)
Similarity:146/303 - (48%) Gaps:54/303 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 RPPSGIDQLPEHPYCGSAF---SFRLVGGHNTGLFEFPWTTLLEYETVSGGK--DYACGASFIAQ 169
            :|.|.:||  :...||...   .|::|||..|.:...||...: |:...||.  .:.||.|.|:.
Mouse   157 KPSSSVDQ--QGFQCGQKALRPRFKIVGGEFTEVENQPWFAAI-YQKNKGGSPPSFKCGGSLISP 218

  Fly   170 RWLLTAAHCIHTMGRNLTAAI-LGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSE- 232
            .|:.:||||...:.:.....: ||:       ..|:..|      |..::..:::::.|..|.| 
Mouse   219 CWVASAAHCFIQLPKKENYVVYLGQ-------SKESSYN------PGEMKFEVEQLILHEYYRED 270

  Fly   233 -LNYRNDIALLRL-------SRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSG 289
             |.|.||||||::       ::|     .::::.:||||   |:.:...||..:::|:||...|.
Mouse   271 SLAYHNDIALLKIRTSTGQCAQP-----SRSIQTICLPP---RFTDAPFGSDCEITGFGKESESD 327

  Fly   290 --SSKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQMCAGG-EIGVDSCSGDSGGPL--TVEANT 349
              ..|..:.:::.:...:||.:..|..::|..  ..:||.. |...|||.|||||||  .:|...
Mouse   328 YLYPKNLKMSVVKLVSHEQCMQPHYYGSEINY--KMLCAADPEWKTDSCKGDSGGPLICNIEGRP 390

  Fly   350 ASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIESTI 392
            .       |:|:||.|| .|......|:|||||.::|||:|.|
Mouse   391 T-------LSGIVSWGR-GCAEKNKPGVYTRVSHFLDWIQSHI 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 79/273 (29%)
Tryp_SPc 133..391 CDD:238113 81/274 (30%)
PlauNP_032899.1 Binds urokinase plasminogen activator surface receptor. /evidence=ECO:0000250 35..58
Kringle 71..152 CDD:333799
Connecting peptide 153..179 6/23 (26%)
Tryp_SPc 180..424 CDD:238113 81/275 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.