DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and try-1

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:276 Identity:83/276 - (30%)
Similarity:115/276 - (41%) Gaps:50/276 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWN 195
            ||:||..:....:|||..|    :|....:.||.|.|...::||||||               :.
 Worm    57 RLIGGSESSPHSWPWTVQL----LSRLGHHRCGGSLIDPNFVLTAAHC---------------FA 102

  Fly   196 RDTDPDCEN-DLNGVRE-CAPPHIRVTIDRILPHAQYSELNYRN--DIALLRLSRPVNWLQMQNL 256
            :|..|...: .:.|.|. ...|| |||...|.|   :..:.:.:  |.|::|:..|||  .....
 Worm   103 KDRRPTSYSVRVGGHRSGSGSPH-RVTAVSIHP---WYNIGFPSSYDFAIMRIHPPVN--TSTTA 161

  Fly   257 EPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQ--CQEAFYKDTKITL 319
            .|:|| |......|:|    ..|:|||.|....|........:|:.....  |........:|.|
 Worm   162 RPICL-PSLPAVENRL----CVVTGWGSTIEGSSLSAPTLREIHVPLLSTLFCSSLPNYIGRIHL 221

  Fly   320 ADSQMCAGGEIG-VDSCSGDSGGPLTVEANTASGNRYVYLAGVVS--IGRKHCGTALFSGIYTRV 381
             .|.:|||...| :|||.|||||||     ..:.:.:..|.||||  ||   |......|:|..|
 Worm   222 -PSMLCAGYSYGKIDSCQGDSGGPL-----MCARDGHWELTGVVSWGIG---CARPGMPGVYGNV 277

  Fly   382 SSYMDWIESTIRANRI 397
            .|...||  .:..||:
 Worm   278 HSASTWI--NLEMNRL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 79/265 (30%)
Tryp_SPc 133..391 CDD:238113 79/266 (30%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 79/266 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.