DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Tpsb2

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:290 Identity:81/290 - (27%)
Similarity:117/290 - (40%) Gaps:86/290 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 LVGGHNTGLFEFPWTTLLEYETVSGGKDY---ACGASFIAQRWLLTAAHCIHTMGRNLTAAILGE 193
            :||||.....::||...|.::.     :|   .||.|.|..:|:||||||:              
Mouse    32 IVGGHEASESKWPWQVSLRFKL-----NYWIHFCGGSLIHPQWVLTAAHCV-------------- 77

  Fly   194 WNRDTDPDCENDLNGVRECAPPHIR--------------------VTIDRILPHAQYSELNYRND 238
                                .|||:                    ::::||:.|..|.......|
Mouse    78 --------------------GPHIKSPQLFRVQLREQYLYYGDQLLSLNRIVVHPHYYTAEGGAD 122

  Fly   239 IALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESS----GSSKIKQKAML 299
            :|||.|..|||  ...:|.|:.|||....:.   .|::..|:|||..::.    ....:|| ..:
Mouse   123 VALLELEVPVN--VSTHLHPISLPPASETFP---PGTSCWVTGWGDIDNDEPLPPPYPLKQ-VKV 181

  Fly   300 HIQPQDQCQEAFYK-----DTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYL- 358
            .|.....|...::.     |....:.|..:|| |....|||.|||||||..:.      :..:| 
Mouse   182 PIVENSLCDRKYHTGLYTGDDFPIVHDGMLCA-GNTRRDSCQGDSGGPLVCKV------KGTWLQ 239

  Fly   359 AGVVSIGRKHCGTALFSGIYTRVSSYMDWI 388
            |||||.| :.|......||||||:.|:|||
Mouse   240 AGVVSWG-EGCAQPNKPGIYTRVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 79/288 (27%)
Tryp_SPc 133..391 CDD:238113 81/289 (28%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 81/290 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.