DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Masp1

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_036015702.1 Gene:Masp1 / 17174 MGIID:88492 Length:746 Species:Mus musculus


Alignment Length:334 Identity:100/334 - (29%)
Similarity:144/334 - (43%) Gaps:67/334 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 PLAPRISNGT---TNATSSTTTLKLLPRTTPRPPSGIDQLPEHPYCG-SAFS----FRLVGGHNT 138
            |....:.|.|   |.:...|.|.::|.|:.|..         .|.|| ..||    .|:..|...
Mouse   405 PYYKMLHNTTGVYTCSAHGTWTNEVLKRSLPTC---------LPVCGVPKFSRKQISRIFNGRPA 460

  Fly   139 GLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIH--------TMGRNLTAA------ 189
            .....||..:|.:   ..|:.: ||.|.:...|:||||||:|        |:..:...:      
Mouse   461 QKGTMPWIAMLSH---LNGQPF-CGGSLLGSNWVLTAAHCLHQSLDPEEPTLHSSYLLSPSDFKI 521

  Fly   190 ILGE-WNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRP--VNWL 251
            |:|: |.|.:|.| |..|         |::    |...|..|:...:.||:.|:.||..  :|..
Mouse   522 IMGKHWRRRSDED-EQHL---------HVK----RTTLHPLYNPSTFENDLGLVELSESPRLNDF 572

  Fly   252 QMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEAFYKDTK 316
            .|    |||||.|     ....|:...||||||.......:...:..:.|...|.|||| |...|
Mouse   573 VM----PVCLPEQ-----PSTEGTMVIVSGWGKQFLQRFPENLMEIEIPIVNSDTCQEA-YTPLK 627

  Fly   317 ITLADSQMCAG-GEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTR 380
            ..:....:||| .|.|.|:|:||||||:..:  .|..::: ||.||||.| :.||.....|:|:.
Mouse   628 KKVTKDMICAGEKEGGKDACAGDSGGPMVTK--DAERDQW-YLVGVVSWG-EDCGKKDRYGVYSY 688

  Fly   381 VSSYMDWIE 389
            :....|||:
Mouse   689 IYPNKDWIQ 697

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 84/274 (31%)
Tryp_SPc 133..391 CDD:238113 85/275 (31%)
Masp1XP_036015702.1 CUB 33..142 CDD:238001
FXa_inhibition 158..186 CDD:405372
CUB 190..299 CDD:395345
PHA02639 <305..>438 CDD:165022 9/41 (22%)
CCP 306..368 CDD:153056
Tryp_SPc 454..699 CDD:238113 85/276 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.