DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Klkb1

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_032481.2 Gene:Klkb1 / 16621 MGIID:102849 Length:638 Species:Mus musculus


Alignment Length:398 Identity:125/398 - (31%)
Similarity:181/398 - (45%) Gaps:107/398 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SVEFGRG------TCIEKKDCDFYAVDKLMELASKQQCFSRQRPDLVCCPRETNIIPPLAPRISN 89
            :|.|.:|      ||.:...|.|:....|.:...::.|        .|..|.:....|  .||:.
Mouse   308 NVTFVQGADVCQETCTKTIRCQFFIYSLLPQDCKEEGC--------KCSLRLSTDGSP--TRITY 362

  Fly    90 GTTNATSSTTTLKLLPRTTPRPPSGIDQLPEHPYCGSAFSFRLVGGHNTGLFEFPWTTLLEYETV 154
            |...  ||..:|:|.            :|.:.|.|.:..:.|:|||.|..|.|:||...|:.:.|
Mouse   363 GMQG--SSGYSLRLC------------KLVDSPDCTTKINARIVGGTNASLGEWPWQVSLQVKLV 413

  Fly   155 SGGKDYACGASFIAQRWLLTAAHCI---------HTMGRNLTAAILGEWNRDTDPDCENDLNGVR 210
            |  :.:.||.|.|.::|:||||||.         ...|..|:   |.|..::|            
Mouse   414 S--QTHLCGGSIIGRQWVLTAAHCFDGIPYPDVWRIYGGILS---LSEITKET------------ 461

  Fly   211 ECAPPHIRVTIDRILPHAQY--SELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLA 273
                |..|  |..::.|.:|  ||.||  ||||::|..|:|:.:.|  :|:|||           
Mouse   462 ----PSSR--IKELIIHQEYKVSEGNY--DIALIKLQTPLNYTEFQ--KPICLP----------- 505

  Fly   274 GSAAD---------VSGWGKTESSGSSK-IKQKAMLHIQPQDQCQEAFYKDTKITLADSQM-CAG 327
             |.||         |:|||.|:..|.:: |.|||.:.:.|.::||:. |:|..|   :.|| |||
Mouse   506 -SKADTNTIYTNCWVTGWGYTKEQGETQNILQKATIPLVPNEECQKK-YRDYVI---NKQMICAG 565

  Fly   328 -GEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWI--- 388
             .|.|.|:|.|||||||..:    ...|: .|.|:.|.| :.|......|:||:||.|||||   
Mouse   566 YKEGGTDACKGDSGGPLVCK----HSGRW-QLVGITSWG-EGCARKDQPGVYTKVSEYMDWILEK 624

  Fly   389 --ESTIRA 394
              .|.:||
Mouse   625 TQSSDVRA 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 10/48 (21%)
Tryp_SPc 131..388 CDD:214473 98/279 (35%)
Tryp_SPc 133..391 CDD:238113 99/285 (35%)
Klkb1NP_032481.2 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 201..284 CDD:128519
APPLE 292..375 CDD:128519 18/78 (23%)
Tryp_SPc 390..621 CDD:214473 98/279 (35%)
Tryp_SPc 391..621 CDD:238113 97/278 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.