DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Klk1b11

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_034770.1 Gene:Klk1b11 / 16613 MGIID:892023 Length:261 Species:Mus musculus


Alignment Length:305 Identity:82/305 - (26%)
Similarity:123/305 - (40%) Gaps:81/305 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 GIDQLPEHPYCGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHC 178
            |||..|       ....|:|||.|......||     :..|.....|.||...:.:.|:||||||
Mouse    14 GIDAAP-------PVQSRIVGGFNCEKNSQPW-----HVAVYRYNKYICGGVLLDRNWVLTAAHC 66

  Fly   179 IHTMGRNLTAAILGEWNRDT-----DPDCENDLNGVRECAPPHIRVTIDRILPHAQYS------- 231
             |....|:       |...|     :|..::.:              :.:..||..|:       
Mouse    67 -HVSQYNV-------WLGKTKLFQREPSAQHRM--------------VSKSFPHPDYNMSLLIIH 109

  Fly   232 ----ELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSK 292
                |.:..||:.|||||.|.:....  ::|:.||.:..:     .||...|||||   |...:|
Mouse   110 NPEPEDDESNDLMLLRLSEPADITDA--VKPIALPTEEPK-----LGSTCLVSGWG---SITPTK 164

  Fly   293 IK-----QKAMLHIQPQDQCQEAFYKDTKITLADSQMCAGGEI--GVDSCSGDSGGPLTVEANTA 350
            .:     |...:.:.|.:.|    .|:....:.|..:|| ||:  |.|:|.|||||||..:.   
Mouse   165 FQTPDDLQCVSIKLLPNEVC----VKNHNQKVTDVMLCA-GEMGGGKDTCKGDSGGPLICDG--- 221

  Fly   351 SGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIESTIRAN 395
                  .|.|:.:.|...||.....|:||::..:.:||:.|:..|
Mouse   222 ------VLHGITAWGPIPCGKPNTPGVYTKLIKFTNWIKDTMAKN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 74/279 (27%)
Tryp_SPc 133..391 CDD:238113 75/280 (27%)
Klk1b11NP_034770.1 Tryp_SPc 24..253 CDD:214473 74/279 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.