DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG43742

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:277 Identity:78/277 - (28%)
Similarity:118/277 - (42%) Gaps:54/277 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTA 188
            |....::|:..||.....:|       ...:....::.||.|.|.::::||||||:..:..  ..
  Fly    27 CKVKITYRVANGHTAITSQF-------MAALYNNSEFFCGGSLIHKQYVLTAAHCVRDLDE--VT 82

  Fly   189 AILGEWNRDTD-PDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQ 252
            ..|||.||... |.|:            |:.....:::.|..:....:.||||||||.|.|  :.
  Fly    83 VHLGENNRSCPIPVCK------------HVLRLNAKVILHPNFHGNIFLNDIALLRLEREV--IF 133

  Fly   253 MQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEAFYKDTKI 317
            ..::.|:|:.......:|......|  .||||||....|.:.....|...|:..|.:..      
  Fly   134 EAHIRPICIILDEDVTSNNQNNFTA--YGWGKTEHGNISDVLSFIDLVRLPKSMCYQNI------ 190

  Fly   318 TLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVY-------LAGVVSIGRKHCGTALFS 375
                :.:|||...| |:|..||||||.       || :|:       |.|:.|.|...| :.|| 
  Fly   191 ----NTICAGSTSG-DTCESDSGGPLI-------GN-FVHRGKSRDILFGITSYGDAEC-SGLF- 240

  Fly   376 GIYTRVSSYMDWIESTI 392
            |:||.|::|..||.|.:
  Fly   241 GVYTDVNAYKSWIASVV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 74/264 (28%)
Tryp_SPc 133..391 CDD:238113 75/265 (28%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 74/264 (28%)
Tryp_SPc 35..256 CDD:238113 75/266 (28%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.