DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG12256

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster


Alignment Length:268 Identity:77/268 - (28%)
Similarity:124/268 - (46%) Gaps:43/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEF-PWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEW 194
            |:|||::....|: |:...:::.|.||...:.||.|.||...:||||||::  |:|.:...:...
  Fly    46 RVVGGYDVPEDEYVPYQVSMQFLTRSGKMRHFCGGSLIAPNRVLTAAHCVN--GQNASRISVVAG 108

  Fly   195 NRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPV 259
            .||.     ||.:|.|.        .:.....:..|.|| ..:|||:|::..|.. |..:.:..:
  Fly   109 IRDL-----NDSSGFRS--------QVQSYEMNENYQEL-VTSDIAILKIDPPFE-LDEKRVSTI 158

  Fly   260 CLPPQRGRYANQLAGSAADV--SGWGKTESSGSS------KIKQKAMLHIQPQDQCQEAFYKDTK 316
            .:.      .:.:.|:..:|  :|||.....|:.      .:.||.........:|     |:|.
  Fly   159 DVS------GSDMVGADQEVLLTGWGSVFHFGTGPFAKYPTVLQKLDYKTLSNSKC-----KETM 212

  Fly   317 ITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRV 381
            ..|.|:::||....|..:|:|||||||.::    ||..|..: ||||.|...|.:. ...:||||
  Fly   213 TQLTDTEICALERFGKGACNGDSGGPLVMK----SGESYKQV-GVVSYGTAFCASN-NPDVYTRV 271

  Fly   382 SSYMDWIE 389
            |.:..||:
  Fly   272 SMFDGWIK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 75/265 (28%)
Tryp_SPc 133..391 CDD:238113 76/266 (29%)
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 75/265 (28%)
Tryp_SPc 47..280 CDD:238113 76/267 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.