DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and F2

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_034298.1 Gene:F2 / 14061 MGIID:88380 Length:618 Species:Mus musculus


Alignment Length:284 Identity:86/284 - (30%)
Similarity:131/284 - (46%) Gaps:51/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWN 195
            |:|.|.:......||..:|..::   .::..||||.|:.||:|||||||          :...|:
Mouse   360 RIVEGWDAEKGIAPWQVMLFRKS---PQELLCGASLISDRWVLTAAHCI----------LYPPWD 411

  Fly   196 RDTDPDCENDLNGVRECAPPHIRV----------TIDRILPHAQYS-ELNYRNDIALLRLSRPVN 249
            ::.   .||||. ||  ...|.|.          .:::|..|.:|: ..|...|||||:|.:||.
Mouse   412 KNF---TENDLL-VR--IGKHSRTRYERNVEKISMLEKIYVHPRYNWRENLDRDIALLKLKKPVP 470

  Fly   250 WLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIK-------QKAMLHIQPQDQC 307
            :  ...:.|||||.::...:...||....|:|||....:.::.|.       |...|.|..:..|
Mouse   471 F--SDYIHPVCLPDKQTVTSLLRAGYKGRVTGWGNLRETWTTNINEIQPSVLQVVNLPIVERPVC 533

  Fly   308 QEAFYKDTKITLADSQMCAGGEIG----VDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKH 368
            :.:    |:|.:.|:..|||.::.    .|:|.||||||..::  :...||: |..|:||.| :.
Mouse   534 KAS----TRIRITDNMFCAGFKVNDTKRGDACEGDSGGPFVMK--SPFNNRW-YQMGIVSWG-EG 590

  Fly   369 CGTALFSGIYTRVSSYMDWIESTI 392
            |......|.||.|.....||:..|
Mouse   591 CDRKGKYGFYTHVFRLKRWIQKVI 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 83/278 (30%)
Tryp_SPc 133..391 CDD:238113 84/279 (30%)
F2NP_034298.1 GLA 25..89 CDD:214503
KR 107..189 CDD:214527
KR 213..295 CDD:214527
Thrombin_light 313..360 CDD:286482 86/284 (30%)
Tryp_SPc 360..610 CDD:214473 83/278 (30%)
Tryp_SPc 361..613 CDD:238113 84/280 (30%)
High affinity receptor-binding region which is also known as the TP508 peptide. /evidence=ECO:0000250 548..570 10/21 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.