DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and F10

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001229297.1 Gene:F10 / 14058 MGIID:103107 Length:493 Species:Mus musculus


Alignment Length:415 Identity:112/415 - (26%)
Similarity:174/415 - (41%) Gaps:95/415 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GNCNSVEFGRGTC-----IEKKDCDFYAVDKLMELASKQQC--FSRQRPDLVCCPRET------- 77
            |.|.. ..|..||     .|.|:|:.: |.||..| ....|  |.|:..:.|.|...:       
Mouse   111 GACRD-GIGGYTCTCSEGFEGKNCELF-VRKLCRL-DNGDCDQFCREEQNSVVCSCASGYFLGND 172

  Fly    78 -----NIIPPLAPRISNG------TTNATSSTTTLK--------LLPRTTP---------RPPSG 114
                 :..|....:|:.|      ..|.:.|...|:        |.|...|         :|...
Mouse   173 GKSCISTAPFPCGKITTGRRKRSVALNTSDSELDLEDALLDEDFLSPTENPIELLNLNETQPERS 237

  Fly   115 IDQLPEHPYCGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCI 179
            .|.|           .|:|||......|.||..||..|...|    .||.:.:.:.::||||||:
Mouse   238 SDDL-----------VRIVGGRECKDGECPWQALLINEDNEG----FCGGTILNEFYILTAAHCL 287

  Fly   180 HTMGRNLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRL 244
            | ..|.....:   .:|:|:.:..|::  |.|         :|.::.|.::....|..|||:|||
Mouse   288 H-QARRFKVRV---GDRNTEKEEGNEM--VHE---------VDVVIKHNKFQRDTYDYDIAVLRL 337

  Fly   245 SRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSG--SSKIKQKAMLHIQPQDQ- 306
            ..|:.:  ..|:.|.|||.:....:..:......|||:|:|...|  |:.:|   ||.:...|: 
Mouse   338 KTPITF--RMNVAPACLPQKDWAESTLMTQKTGIVSGFGRTHEKGRQSNILK---MLEVPYVDRN 397

  Fly   307 -CQEAFYKDTKITLADSQMCAGGEIGV-DSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHC 369
             |:    ..|..::..:..|||.|..: |:|.||||||..    |...|.| |:.|:||.| :.|
Mouse   398 TCK----LSTSFSITQNMFCAGYEAKLEDACQGDSGGPHV----TRFKNTY-YVTGIVSWG-EGC 452

  Fly   370 GTALFSGIYTRVSSYMDWIESTIRA 394
            ......||||:|::::.||:.:::|
Mouse   453 ARKGKYGIYTKVTTFLKWIDRSMKA 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 15/51 (29%)
Tryp_SPc 131..388 CDD:214473 80/261 (31%)
Tryp_SPc 133..391 CDD:238113 81/262 (31%)
F10NP_001229297.1 GLA 36..97 CDD:214503
EGF_CA 98..134 CDD:238011 7/23 (30%)
FXa_inhibition 141..176 CDD:291342 6/35 (17%)
Tryp_SPc 243..471 CDD:214473 80/261 (31%)
Tryp_SPc 244..473 CDD:238113 81/262 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.