DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Egfbp2

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_034245.3 Gene:Egfbp2 / 13647 MGIID:95292 Length:261 Species:Mus musculus


Alignment Length:295 Identity:84/295 - (28%)
Similarity:128/295 - (43%) Gaps:61/295 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 GIDQLPEHPYCGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHC 178
            |||..|       ....|:|||.|......||...:.|:     |::.||...:.:.|:||||||
Mouse    14 GIDAAP-------PLQSRVVGGFNCKKNSQPWQVAVYYQ-----KEHICGGVLLDRNWVLTAAHC 66

  Fly   179 IHT-----MGRNLTAAILGEWNRDTDPDCENDLNGVRECAP-PHIRVT---IDRILPHAQYSELN 234
            ...     :|:|   .:..|     :|..::.|  |.:..| |...::   :..|.|.|.:|   
Mouse    67 YVDQYEVWLGKN---KLFQE-----EPSAQHRL--VSKSFPHPGFNMSLLMLQTIPPGADFS--- 118

  Fly   235 YRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIK--QKA 297
              ||:.|||||:|.:...:  ::|:.||.:..:     .||....||||....:...|..  |..
Mouse   119 --NDLMLLRLSKPADITDV--VKPIALPTKEPK-----PGSKCLASGWGSITPTRWQKPDDLQCV 174

  Fly   298 MLHIQPQDQCQEAFYKDTKITLADSQMCAGGEI--GVDSCSGDSGGPLTVEANTASGNRYVYLAG 360
            .:.:.|.:.|.:.:.:  |:|  |..:|| ||:  |.|:|..||||||..:.         .|.|
Mouse   175 FITLLPNENCAKVYLQ--KVT--DVMLCA-GEMGGGKDTCRDDSGGPLICDG---------ILQG 225

  Fly   361 VVSIGRKHCGTALFSGIYTRVSSYMDWIESTIRAN 395
            ..|.|...||......|||.:..:..||:.|:..|
Mouse   226 TTSYGPVPCGKPGVPAIYTNLIKFNSWIKDTMMKN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 76/269 (28%)
Tryp_SPc 133..391 CDD:238113 77/270 (29%)
Egfbp2NP_034245.3 Tryp_SPc 24..253 CDD:214473 76/269 (28%)
Tryp_SPc 25..256 CDD:238113 77/271 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.