DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and TMPRSS11B

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_872308.2 Gene:TMPRSS11B / 132724 HGNCID:25398 Length:416 Species:Homo sapiens


Alignment Length:264 Identity:81/264 - (30%)
Similarity:127/264 - (48%) Gaps:39/264 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWN 195
            ::|.|.::....:||...::::    |:.| ||||.|:.||||:||||......:      .:|.
Human   184 KIVNGKSSLEGAWPWQASMQWK----GRHY-CGASLISSRWLLSAAHCFAKKNNS------KDWT 237

  Fly   196 RDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVC 260
                      :|.......|::...:..|:.|..||.....:||||::|:..|::.:.  :..:|
Human   238 ----------VNFGIVVNKPYMTRKVQNIIFHENYSSPGLHDDIALVQLAEEVSFTEY--IRKIC 290

  Fly   261 LPPQRGRYANQLAGSAADVSGWGKTESSGS-SKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQM 324
            ||..:.:.:.   .....|:|||....:|| ..|.|:..|.|.....|..::.....:|  |:.:
Human   291 LPEAKMKLSE---NDNVVVTGWGTLYMNGSFPVILQEDFLKIIDNKICNASYAYSGFVT--DTML 350

  Fly   325 CAG---GEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMD 386
            |||   ||  .|:|..||||||   |...|.|.: :|.|:||.| ..||.....|:||||:||.:
Human   351 CAGFMSGE--ADACQNDSGGPL---AYPDSRNIW-HLVGIVSWG-DGCGKKNKPGVYTRVTSYRN 408

  Fly   387 WIES 390
            ||.|
Human   409 WITS 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 78/260 (30%)
Tryp_SPc 133..391 CDD:238113 81/262 (31%)
TMPRSS11BNP_872308.2 SEA 45..143 CDD:279699
Tryp_SPc 184..410 CDD:214473 78/260 (30%)
Tryp_SPc 185..413 CDD:238113 81/263 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.