DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP011719

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_320793.4 Gene:AgaP_AGAP011719 / 1280920 VectorBaseID:AGAP011719 Length:762 Species:Anopheles gambiae


Alignment Length:269 Identity:80/269 - (29%)
Similarity:122/269 - (45%) Gaps:49/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 EFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAI--LGEWNR-DTDPDCE 203
            ||.....:.:....|...:.||.|.|.:.::||||||.......|:..:  :|:.|. |.|.|  
Mosquito    29 EFAHIAAIGWTQPDGTVQWKCGGSLIWENYILTAAHCYADPDTILSPDVIRIGDLNLFDADDD-- 91

  Fly   204 NDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRY 268
               ..|:|       ..|.:|:.|..::......|:|||:|.:.|  :|.:.:.|.||     ..
Mosquito    92 ---EFVQE-------RKIVQIIRHPLHNASTVYYDLALLKLDKKV--IQSEGVIPTCL-----WL 139

  Fly   269 ANQLAGSAADVSGWGKTESSGSSKIKQ----KAMLHIQPQDQCQEAFYKDTK----ITLADSQMC 325
            .:.:..|..:|:|||:|   |..|.|.    ||.|.:....:|.:...|.|:    ..|||.|:|
Mosquito   140 DDSIPFSTLEVAGWGQT---GFGKEKSNMLLKAELKLMTNTECAKYNNKRTQRRLGNDLADHQLC 201

  Fly   326 AGGEIGVDSCSGDSGGPLTVEANTASGNRYV------YLAGVVSIGRKHCGTALFSGIYTRVSSY 384
            |..|: :|:|.|||||||..       |.|.      :|.||.|.| |.|..:. .|:|.:|:.:
Mosquito   202 AWDEV-MDTCPGDSGGPLHY-------NLYYKHTKIPFLVGVTSFG-KACAVSQ-PGVYVKVAKF 256

  Fly   385 MDWIESTIR 393
            ..||..|::
Mosquito   257 KQWIIETLQ 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 77/262 (29%)
Tryp_SPc 133..391 CDD:238113 79/265 (30%)
AgaP_AGAP011719XP_320793.4 Tryp_SPc 19..263 CDD:238113 79/265 (30%)
Tryp_SPc 19..260 CDD:214473 77/262 (29%)
Tryp_SPc 318..537 CDD:304450
Tryp_SPc 653..>762 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.