DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP012328

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_320219.3 Gene:AgaP_AGAP012328 / 1280372 VectorBaseID:AGAP012328 Length:324 Species:Anopheles gambiae


Alignment Length:270 Identity:95/270 - (35%)
Similarity:144/270 - (53%) Gaps:14/270 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CGSAFSFRLVGGHNTGLFEFPWTTLLEY-ETVSGGKDYACGASFIAQRWLLTAAHCIHTM--GRN 185
            ||.....|:|||..|.:.::||..||:| ....|.|.:|||.:.:.::::|:||||...:  |..
Mosquito    55 CGVQMDNRIVGGQRTSIDQYPWMALLQYINHRKGTKRFACGGALLNRKFVLSAAHCFVRLPAGVE 119

  Fly   186 LTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQY--SELNYRNDIALLRLSRPV 248
            |....||||:.|::.||| ||:....||.|...:..:||:.|..|  :..:..|||||:.||...
Mosquito   120 LHKVRLGEWDTDSEIDCE-DLDDELSCASPVQDLDYERIIIHEGYTGNHADRENDIALIELSGSA 183

  Fly   249 NWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEAFYK 313
            .:...  ::|:|||........:|...:...:|||:||::..|:.|....|.:.....|.|.:.:
Mosquito   184 KYNDF--VKPICLPEPGTPNKEKLYFGSMWAAGWGRTETASGSRFKLYVPLDLFDLQSCNETYQR 246

  Fly   314 DTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIY 378
            ..|:.|.::|.||.|..|.|:|:|||||||.....|..     |:.||||.|.:.||:.: ..:|
Mosquito   247 RVKVPLTETQFCAMGTPGKDTCNGDSGGPLMKTMKTLH-----YVVGVVSFGPQRCGSGI-PAVY 305

  Fly   379 TRVSSYMDWI 388
            |||..:.|||
Mosquito   306 TRVDKFYDWI 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 91/261 (35%)
Tryp_SPc 133..391 CDD:238113 92/261 (35%)
AgaP_AGAP012328XP_320219.3 CLIP 1..45 CDD:295450
Tryp_SPc 62..315 CDD:214473 91/261 (35%)
Tryp_SPc 63..315 CDD:238113 90/260 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.