DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP009249

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_320028.4 Gene:AgaP_AGAP009249 / 1280205 VectorBaseID:AGAP009249 Length:776 Species:Anopheles gambiae


Alignment Length:259 Identity:71/259 - (27%)
Similarity:120/259 - (46%) Gaps:44/259 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 WTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAI-----LGEWNRDTDPDCEN 204
            ||      .:.|...:.|..:.:.:.::||:|.|. |.|:.:|..:     |..:|...|...: 
Mosquito    38 WT------GIDGTVRWNCSGTLVWENFILTSARCT-TDGKYVTIYVARFGDLDLFNATDDQYAQ- 94

  Fly   205 DLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYA 269
                         ::.|..|:.|.::...:..:||||:||.|.|  :....:.|.||...     
Mosquito    95 -------------QLKIVEIIRHPEHRHRDRYHDIALMRLERKV--VLHDTVAPACLWTD----- 139

  Fly   270 NQLAGSAADVSGWGKTE-SSGSSKIKQKAMLHIQPQDQCQEAF--YKDTKITLADSQMCAGGEIG 331
            :::.....:.:|||.|. ::..:.|..|..|.....:||.|.:  .:..:..|..:|:|| |:..
Mosquito   140 DEIRFKRFEATGWGDTGFAAAKTPILLKVALSPVANEQCNEHYSNLRGLRNGLHANQLCA-GDAR 203

  Fly   332 VDSCSGDSGGPLTVEA--NTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIESTIR 393
            :|:|.|||||||.|:.  ||   ....:|.||.|.|.. ||.:: .|:||||:.|:.||.|.::
Mosquito   204 MDTCPGDSGGPLQVKLLHNT---RETPFLVGVTSFGLA-CGLSV-PGVYTRVAPYVPWIRSVLK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 68/252 (27%)
Tryp_SPc 133..391 CDD:238113 70/255 (27%)
AgaP_AGAP009249XP_320028.4 Trypsin 43..257 CDD:278516 66/241 (27%)
Tryp_SPc 46..260 CDD:238113 67/241 (28%)
Tryp_SPc 312..552 CDD:304450
Tryp_SPc 654..>751 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.