DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP009211

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_319989.4 Gene:AgaP_AGAP009211 / 1280170 VectorBaseID:AGAP009211 Length:265 Species:Anopheles gambiae


Alignment Length:274 Identity:97/274 - (35%)
Similarity:133/274 - (48%) Gaps:26/274 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTA 188
            ||......:..|.....:.|||..|||   .|...|..||.|.|:.|.:||||||:....|:...
Mosquito     1 CGVTRVQLIAYGQPARAYAFPWMALLE---TSVSDDLPCGGSLISDRHILTAAHCVKARKRDCDD 62

  Fly   189 AILGEWNRDTDPDC--ENDLNGVR---ECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPV 248
            .|   ..:|.:.|.  ..:.:|..   .|.||..|:.|:.|:.|.:||..:.|||:|::||..|.
Mosquito    63 RI---HFKDDEYDSGESEEADGAEYSASCGPPAQRIPIETIVTHPKYSARSKRNDLAIIRLQYPA 124

  Fly   249 NWLQMQNLEPVCLPPQRGRYANQL-AGSAAD--VSGWGKTESSGSSKIKQKAMLHIQPQDQCQEA 310
              :...|:.|:|||     ...|| |...||  |:|||.||:...|.:.:.|:|...|...|...
Mosquito   125 --IIGYNVIPICLP-----LTEQLRAYRPADSFVTGWGLTETGQRSAVLRYAILPALPLPDCAMR 182

  Fly   311 FYK-DTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALF 374
            ..: |..|.|.|..:||||......|.|||||||..   .:...|:| |.||||.|.|.|||.:.
Mosquito   183 IKELDRIIVLDDGHLCAGGNNRTAHCHGDSGGPLQY---VSDSTRFV-LQGVVSFGVKTCGTKIA 243

  Fly   375 SGIYTRVSSYMDWI 388
            .|::..|:.::|||
Mosquito   244 PGVFANVTHFIDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 93/265 (35%)
Tryp_SPc 133..391 CDD:238113 95/265 (36%)
AgaP_AGAP009211XP_319989.4 Tryp_SPc 9..257 CDD:214473 93/264 (35%)
Tryp_SPc 9..257 CDD:238113 93/264 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.