DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG43336

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:328 Identity:90/328 - (27%)
Similarity:134/328 - (40%) Gaps:77/328 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 SRQRPDLVCCPRETNIIPPLAPRISNGTTNATSSTTTLKLLPRTTPRPPSGIDQLPEHPYCGSAF 128
            |.|..|:.|..|..:   |..||:.|||..:.:|:                              
  Fly    18 STQFLDMACGIRAHS---PSVPRVKNGTVASLTSS------------------------------ 49

  Fly   129 SFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGE 193
                           ||...|.    |....:.||.|.|..|.:||||||.  :.|....|.|||
  Fly    50 ---------------PWMAFLH----STDGRFICGGSLITNRLVLTAAHCF--LDRTELVARLGE 93

  Fly   194 WNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEP 258
            ::|:....|.:.....|      |...::|...|..|:.:....|||:|||.|.|.:  ..|:.|
  Fly    94 YDREEYEMCHDSYCTYR------IEAMVERGFRHRHYNPMTMAYDIAILRLYRKVQY--TDNIRP 150

  Fly   259 VC--LPPQRGRYANQLAGSAADVSGWGKTESSG-SSKIKQKAMLHIQPQDQCQEAFYKDTKITLA 320
            :|  :.|:..:|.:.|  .....:|||||||.| |:|::...:....|     |...:...::|.
  Fly   151 ICIVIDPRWRKYIDSL--DPLTGTGWGKTESEGDSAKLRTVDLARKHP-----EVCRRYATLSLT 208

  Fly   321 DSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYM 385
            .:|.|||.|.. :.|:||||||:..........|:|.: |:.|.....|   :...::|.|.||:
  Fly   209 ANQFCAGNERS-NLCNGDSGGPVGALIPYGKSKRFVQV-GIASFTNTQC---VMVSVFTDVMSYV 268

  Fly   386 DWI 388
            |||
  Fly   269 DWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 4/9 (44%)
Tryp_SPc 131..388 CDD:214473 76/259 (29%)
Tryp_SPc 133..391 CDD:238113 78/259 (30%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 81/304 (27%)
Tryp_SPc 40..271 CDD:238113 80/301 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.